DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and Ttc16

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_796358.2 Gene:Ttc16 / 338348 MGIID:2443048 Length:824 Species:Mus musculus


Alignment Length:257 Identity:53/257 - (20%)
Similarity:95/257 - (36%) Gaps:66/257 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SQTEEDIKISIELNRLVTRKPDVVLLPQYLKFNNPPIFFERHLAQEIDEMASFCRIFKNEARIVL 69
            ||..|..|  ::|:|::...|..: .||......   ..||..||.:      .:::|.| |:..
Mouse   509 SQVAELAK--LQLSRMIENGPKNI-YPQSTVVQR---LLERRKAQVL------VKLWKQE-RLGT 560

  Fly    70 VKKEKGLW--PEMFQKLDKEALMQKRLEIADLIVERN------------------------KKRD 108
            .::|..|:  |::.:: .|....::|..:.|...::.                        |...
Mouse   561 PEEEVTLYQAPQLAEE-KKVKTARRRTSLTDSYADQTSSGSVFSIVSISTSGPEMSTSQEYKSSS 624

  Fly   109 EKALERYDN---KRRAEIQKEIQRETDMRERVKQFQENSVREALVV----DVRKEAKAT--PKPD 164
            ..|:|..::   |.:..:.::.|..|...:.|:...||.::.|..|    ..|...|||  |||.
Mouse   625 HTAIESSESTLLKPQLSVPRKSQELTWSPKVVQAVTENLIQNATEVTPAYGQRDSKKATQVPKPK 689

  Fly   165 TLQYP--PSSGGASRLATPLMRPPMS--------------SVRGSG-RINVNFTTQHKRVTP 209
            ..:.|  ||...::..|....||..|              :||..| ::....::|....||
Mouse   690 KTEDPKDPSQSTSTTEAPEGPRPSKSRSTLSVKERIRRAKAVRAQGWKLKAQRSSQKVTKTP 751

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 19/77 (25%)
Ttc16NP_796358.2 TPR repeat 75..103 CDD:276809
TPR 87..381 CDD:223533
TPR repeat 108..138 CDD:276809
TPR repeat 143..170 CDD:276809
TPR repeat 183..213 CDD:276809
TPR repeat 218..245 CDD:276809
TPR repeat 299..327 CDD:276809
TPR repeat 347..373 CDD:276809
TPR repeat 378..408 CDD:276809
TPR_11 381..451 CDD:290150
TPR_1 382..410 CDD:278916
TPR repeat 413..448 CDD:276809
TPR_11 426..485 CDD:290150
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.