DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and ifit15

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001288040.1 Gene:ifit15 / 322336 ZFINID:ZDB-GENE-030131-1055 Length:429 Species:Danio rerio


Alignment Length:198 Identity:37/198 - (18%)
Similarity:72/198 - (36%) Gaps:60/198 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 DKEALMQKRLEIADLIVERNKKRDEKALERYDNKRR--------AEIQK---------EIQR--- 129
            |:|||  :.|:.|:.::: .:..:|.|:....||..        .|::|         |:||   
Zfish    62 DREAL--ESLQKAESVIQ-EQGTEETAVRLLVNKANMAWVHFHLGELEKSRGYLEELEELQRIHP 123

  Fly   130 ---------ETDMRERVKQFQENSVREALVVDVRKEAKATPKPDTLQYPPSSGGASRLA------ 179
                     |....:.....:.|..::.|.:|..|.| ...:|:..::  ..|.|..::      
Zfish   124 APPGCPLHPEVSGEKGWTLVKFNKSKKRLAIDYFKMA-LEAEPERKEW--HKGLAISMSKACLWY 185

  Fly   180 --TPLMRPP-MSSVRGSGRINVN-------------FTTQHKRVTPKRESQAAMEKAYAAAGGPN 228
              ||..:.. :..|:.:..||.|             :.|   :|..:||.:..:|:.......|.
Zfish   186 KCTPEQKAEILEKVKTAAEINPNDLLLQALYLVKLSYVT---KVNVEREMRDLLERCLEIVNVPG 247

  Fly   229 ANV 231
            .|:
Zfish   248 LNI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226
ifit15NP_001288040.1 TPR_11 <50..>368 CDD:330823 37/198 (19%)
TPR repeat 323..356 CDD:276809
TPR repeat 361..390 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.