| Sequence 1: | NP_609491.1 | Gene: | CG14921 / 34547 | FlyBaseID: | FBgn0032345 | Length: | 240 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_017450330.2 | Gene: | Tmtc3 / 314785 | RGDID: | 1306351 | Length: | 1022 | Species: | Rattus norvegicus |
| Alignment Length: | 269 | Identity: | 56/269 - (20%) |
|---|---|---|---|
| Similarity: | 101/269 - (37%) | Gaps: | 71/269 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 34 LKFNNPPIFFERHL-AQEIDEMASFCRIFKNEARIVLVKKEKGLWPEMFQKLDKEALMQKRLEIA 97
Fly 98 ----DLIVERN---KKRDE--KALERYDNKRRAEI-------------QKEIQRETDMRERVK-- 138
Fly 139 -QFQENSVREALVV-DVRKEAKATP-KPDTLQYPPSS------------------GGASRLATPL 182
Fly 183 MRPPMSSVRGSGRINVNFTTQHKRVTPKR---ESQA-AMEKAY------------AAAGGPNANV 231
Fly 232 QSPMESVDE 240 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG14921 | NP_609491.1 | p23_DYX1C1_like | 4..81 | CDD:107226 | 14/47 (30%) |
| Tmtc3 | XP_017450330.2 | DUF1736 | 366..438 | CDD:400627 | |
| PEP_TPR_lipo | <542..909 | CDD:274350 | 48/232 (21%) | ||
| TPR repeat | 553..581 | CDD:276809 | |||
| TPR repeat | 586..630 | CDD:276809 | |||
| TPR repeat | 637..664 | CDD:276809 | |||
| TPR repeat | 669..699 | CDD:276809 | 7/17 (41%) | ||
| TPR repeat | 704..732 | CDD:276809 | 5/30 (17%) | ||
| TPR repeat | 775..803 | CDD:276809 | 4/27 (15%) | ||
| TPR repeat | 808..838 | CDD:276809 | 9/29 (31%) | ||
| TPR repeat | 843..872 | CDD:276809 | 2/28 (7%) | ||
| TPR repeat | 878..901 | CDD:276809 | 4/22 (18%) | ||
| ParB_N_Srx | 901..>943 | CDD:421688 | 10/44 (23%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||