DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and Ifit2

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001019924.1 Gene:Ifit2 / 294091 RGDID:1307804 Length:464 Species:Rattus norvegicus


Alignment Length:210 Identity:38/210 - (18%)
Similarity:87/210 - (41%) Gaps:53/210 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PDVVLLPQYLKFNNPP-IFFERHL-----AQE-IDEMASFCRIFKNEARI--VLVKKEKGLWPEM 80
            ||.:.:...:.:.|.. :::  |:     ||| :|::...|:.|.:..||  .::..|:| |..:
  Rat    86 PDQIEIKSLVTWGNYAWVYY--HMGQLSKAQEYLDKVKQVCKKFSSPYRIENPVLDCEEG-WARL 147

  Fly    81 FQKLDKEALMQKRLEIA-DLIVERNKKRDEK----ALERY-------DNKRRAEIQKEIQRETD- 132
              |..|.  ..:|:::. :..:|::.|..|.    |:..|       .|.....:::.|....| 
  Rat   148 --KCTKN--QNERMKVCFEKALEKDPKNPESTSGWAIANYRLDDWPASNDYIDSLEQAISLSPDN 208

  Fly   133 ------MRERVKQFQENSVREALVVDVRKEAKATPKPDTLQYPPSSGGASRL---------ATPL 182
                  :..::::..||..:|.:...::|:..|.   ||:.      ||::.         |..|
  Rat   209 TYVKVLLAMKLEEVHENRAKELVEEALKKDPSAI---DTML------GAAKFYVKVHDTDRAIQL 264

  Fly   183 MRPPMSSVRGSGRIN 197
            ::..:.|:..:..::
  Rat   265 LKKALESMPNNAYVH 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 15/64 (23%)
Ifit2NP_001019924.1 TPR_12 51..126 CDD:290160 9/41 (22%)
TPR repeat 96..122 CDD:276809 6/27 (22%)
TPR repeat 127..167 CDD:276809 9/44 (20%)
TPR repeat 242..270 CDD:276809 6/36 (17%)
TPR repeat 275..325 CDD:276809 0/5 (0%)
TPR repeat 330..355 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.