DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and Ifit1bl

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_220058.2 Gene:Ifit1bl / 294090 RGDID:1304872 Length:473 Species:Rattus norvegicus


Alignment Length:104 Identity:26/104 - (25%)
Similarity:40/104 - (38%) Gaps:20/104 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ERHLAQEID-EMASFCRIFKNEARIVLVKKEKGLWPEM-----------FQKLDKEALMQKRLEI 96
            |.|:.|||. ....|.:.......|.:....|||..|:           .||| .|..||:.:.:
  Rat   372 EVHMQQEIHFRYGKFQQFHMKSENIAITHYLKGLKIEVTSIFRDKLLKALQKL-AERRMQQNVHV 435

  Fly    97 ADLI-----VERNKKRDEKALERYDNKRRAEIQKEIQRE 130
            .:.:     |.|.|....||:..|:...|  :.:|:..|
  Rat   436 LESLSLLGFVYRLKGDTRKAMSCYEKALR--LTEELNPE 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 11/48 (23%)
Ifit1blXP_220058.2 TPR_12 62..132 CDD:290160
TNFRSF <124..>167 CDD:304602
TPR repeat 144..174 CDD:276809
TPR_11 214..280 CDD:290150
TPR repeat 214..244 CDD:276809
TPR repeat 282..333 CDD:276809
TPR repeat 338..366 CDD:276809
TPR repeat 371..406 CDD:276809 9/33 (27%)
TPR repeat 412..464 CDD:276809 12/52 (23%)
TPR_1 437..473 CDD:278916 9/38 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.