DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14921 and Uty

DIOPT Version :9

Sequence 1:	NP_609491.1	Gene:	CG14921 / 34547	FlyBaseID:	FBgn0032345	Length:	240	Species:	Drosophila melanogaster
Sequence 2:	XP_017174175.1	Gene:	Uty / 22290	MGIID:	894810	Length:	1236	Species:	Mus musculus

Alignment Length:	127	Identity:	26/127 - (20%)
Similarity:	51/127 - (40%)	Gaps:	21/127 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly    38 NPP---IFFERHLAQEIDEMASFCRIFKNEARIV-----LVKKEKGLW-PEMFQKLDKEALMQKR 93
            |||   |:.|.........:..||...||...::     .:|.:.||: .:...:.:.|.:::.|
Mouse   773 NPPTPSIYLENKRDAFFPPLHQFCINPKNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHIVEVR 837

  Fly    94 LEIADLIVERNKKRDEKALERYDNK------------RRAEIQKEIQRETDMRERVKQFQEN 143
            .::.....|.......|.:.||:||            :....|:.::.|.:.|.:||.:.:|
Mouse   838 TQLLQPADENWDPSGTKKIWRYENKSSHTTIAKYAQYQACSFQESLREENERRTQVKDYSDN 899

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14921	NP_609491.1	p23_DYX1C1_like	4..81	CDD:107226	12/51 (24%)
Uty	XP_017174175.1	TPR repeat	88..116	CDD:276809
		TPR repeat	121..178	CDD:276809
		TPR	130..397	CDD:223533
		TPR repeat	183..213	CDD:276809
		TPR repeat	224..252	CDD:276809
		TPR repeat	262..297	CDD:276809
		TPR repeat	304..331	CDD:276809
		TPR repeat	336..366	CDD:276809
		TPR repeat	371..399	CDD:276809
		JmjC	935..999	CDD:214721
		JmjC	969..1077	CDD:334913
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900