DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and Kdm6a

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_006527657.1 Gene:Kdm6a / 22289 MGIID:1095419 Length:1476 Species:Mus musculus


Alignment Length:168 Identity:35/168 - (20%)
Similarity:63/168 - (37%) Gaps:19/168 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NPP---IFFERHLAQEIDEMASFCRIFKNEARIVLVKKEKGLWPEMFQKLDKEALMQKRLEIA-- 97
            |||   |:.|.........:..||....|...::     :||...:  |||......|.|..|  
Mouse   989 NPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVI-----RGLAGAL--KLDLGLFSTKTLVEANN 1046

  Fly    98 DLIVERNKKRDEKALERYDNKRRAEI-QKEIQRETDMRERVKQFQENSVREALVVDVRKEAKATP 161
            :.:||...:..:.|.|.:|.....:| ..|..|......:..|:|.:|.:|:|..:..|.:....
Mouse  1047 EHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKD 1111

  Fly   162 KPDTLQYPPSSGGASRLATPLMRPPMSSVRGSGRINVN 199
            ..|:......:.|..|      :.|..:::....|:::
Mouse  1112 HSDSESTSSDNSGKRR------KGPFKTIKFGTNIDLS 1143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 10/45 (22%)
Kdm6aXP_006527657.1 TPR repeat 95..123 CDD:276809
TPR 108..401 CDD:223533
TPR repeat 131..161 CDD:276809
TPR repeat 166..196 CDD:276809
TPR repeat 207..235 CDD:276809
TPR repeat 287..314 CDD:276809
TPR repeat 319..349 CDD:276809
TPR repeat 354..380 CDD:276809
JmjC 1151..1215 CDD:214721
JmjC 1185..1293 CDD:334913
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.