DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and Kdm6b

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_030101676.1 Gene:Kdm6b / 216850 MGIID:2448492 Length:1642 Species:Mus musculus


Alignment Length:229 Identity:47/229 - (20%)
Similarity:89/229 - (38%) Gaps:80/229 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 EARIVLVKKEKGLWPEMFQKLDKEALM-----QKRLEIADLIV----------ERNKKRDEKALE 113
            |.:|.|:|.|.|         |||..:     ::||.:|||.:          .:|.|...|..|
Mouse  1100 ELKIRLIKVESG---------DKETFIASEVEERRLRMADLTISHCAADVMRASKNAKVKGKFRE 1155

  Fly   114 RYDNKRRAEIQKEIQRETDMRERVKQFQENSVREALVVDVRKEAKATPKPDTLQYPPSSGGASRL 178
            .|.:..:: ::.:|..|    |::.:.:.|....::.::.:::|.:   |..||:         .
Mouse  1156 SYLSPAQS-VKPKINTE----EKLPREKLNPPTPSIYLESKRDAFS---PVLLQF---------C 1203

  Fly   179 ATPLMRPPMSSVRG-SGRINVN---FTT--------QH---------------------KRVTPK 210
            ..|  |.|::.:|| :|.:.:|   |:|        :|                     :::.|.
Mouse  1204 TDP--RNPITVIRGLAGSLRLNLGLFSTKTLVEASGEHTVEVRTQVQQPSDENWDLTGTRQIWPC 1266

  Fly   211 RESQA----AMEKAYAAAGGPNANVQSPMESVDE 240
            ..|::    |....|.|:....:..|...||.||
Mouse  1267 ESSRSHTTIAKYAQYQASSFQESLQQEERESEDE 1300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 6/16 (38%)
Kdm6bXP_030101676.1 TPR repeat 106..136 CDD:276809
JmjC 1342..1406 CDD:214721
JmjC 1376..1484 CDD:396791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.