Sequence 1: | NP_609491.1 | Gene: | CG14921 / 34547 | FlyBaseID: | FBgn0032345 | Length: | 240 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_030101676.1 | Gene: | Kdm6b / 216850 | MGIID: | 2448492 | Length: | 1642 | Species: | Mus musculus |
Alignment Length: | 229 | Identity: | 47/229 - (20%) |
---|---|---|---|
Similarity: | 89/229 - (38%) | Gaps: | 80/229 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 EARIVLVKKEKGLWPEMFQKLDKEALM-----QKRLEIADLIV----------ERNKKRDEKALE 113
Fly 114 RYDNKRRAEIQKEIQRETDMRERVKQFQENSVREALVVDVRKEAKATPKPDTLQYPPSSGGASRL 178
Fly 179 ATPLMRPPMSSVRG-SGRINVN---FTT--------QH---------------------KRVTPK 210
Fly 211 RESQA----AMEKAYAAAGGPNANVQSPMESVDE 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14921 | NP_609491.1 | p23_DYX1C1_like | 4..81 | CDD:107226 | 6/16 (38%) |
Kdm6b | XP_030101676.1 | TPR repeat | 106..136 | CDD:276809 | |
JmjC | 1342..1406 | CDD:214721 | |||
JmjC | 1376..1484 | CDD:396791 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |