DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and Ttc24

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_766114.1 Gene:Ttc24 / 214191 MGIID:2443841 Length:334 Species:Mus musculus


Alignment Length:192 Identity:43/192 - (22%)
Similarity:69/192 - (35%) Gaps:58/192 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QISQTEEDIKISIELNRLVTRKPDVVLLPQYLKFNNPPIFFERHLAQEIDEMASFCRIFKNEARI 67
            ::.|.::.:|...|...|...:|..|.              ||.:|:..|.|.:|          
Mouse   164 RLGQHDQALKYYKEALALCQHEPSSVR--------------ERLVAKLADAMRTF---------- 204

  Fly    68 VLVKKEKGLWPEMFQKLDKEALMQKR-LEIADLIVERNKKRDEKALERYDNKRRAEIQKEIQRET 131
              |.:||              :.|.| |..|...::.::|  .|...|..:.  ||..:|.|.|.
Mouse   205 --VAQEK--------------IAQARFLPSAPGKLQTSRK--AKTSARVQSS--AEDAQESQWEG 249

  Fly   132 DMRE--RVKQFQENSVREALVVDVRKEAKAT-------PKPDTLQYP----PSSGGASRLAT 180
            :..|  ..|:..|..|..|.|:..:::.:||       |.|...:||    |.....||.:|
Mouse   250 EASEGGHEKKEMEGLVNTATVLGPQRQNRATTHLPSGGPSPSGEEYPFIIAPKKLRVSRSST 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 15/76 (20%)
Ttc24NP_766114.1 TPR 1 35..68
TPR repeat 38..66 CDD:276809
TPR_12 68..144 CDD:290160
TPR 2 72..105
TPR repeat 72..100 CDD:276809
TPR repeat 111..141 CDD:276809
TPR 3 112..145
TPR_12 113..183 CDD:290160 4/18 (22%)
TPR 4 152..185 4/20 (20%)
TPR_1 152..184 CDD:278916 4/19 (21%)
TPR repeat 152..180 CDD:276809 3/15 (20%)
TPR_12 158..214 CDD:290160 16/89 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..258 9/41 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.