DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14921 and TTC24

DIOPT Version :9

Sequence 1:	NP_609491.1	Gene:	CG14921 / 34547	FlyBaseID:	FBgn0032345	Length:	240	Species:	Drosophila melanogaster
Sequence 2:	NP_001099139.2	Gene:	TTC24 / 164118	HGNCID:	32348	Length:	582	Species:	Homo sapiens

Alignment Length:	127	Identity:	39/127 - (30%)
Similarity:	55/127 - (43%)	Gaps:	19/127 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   112 LERYDN--KRRAEIQKEIQRETD-MRERVKQFQENSVREALV-VDVRKEAKATPKPDTLQYPPSS 172
            |.:||.  |...|...:.|:|.| :|||:.....::||..|. |.:.:....|..|..||.|
Human   366 LGQYDQALKYYKEALAQCQKEPDSVRERLVAKLADTVRTRLAQVGLVQTHTLTSAPGRLQAP--- 427

  Fly   173 GGASRL-ATPLMRPPMSSVRG------SGRINVNFTTQHKRVTPKRESQAAMEKAYAAAGGP 227
            ||||:. .||....  ||..|      ||..:..|...|::   |:|.::|.....|..|.|
Human   428 GGASQAEGTPAKAG--SSTAGVQHRSSSGWEDEEFEEGHQK---KKEERSANVPVRAGPGRP 484

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14921	NP_609491.1	p23_DYX1C1_like	4..81	CDD:107226
TTC24	NP_001099139.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..31
		TPR_12	36..105	CDD:290160
		TPR 1	36..69
		TPR repeat	36..64	CDD:276809
		TPR 2	79..112
		TPR_12	80..148	CDD:290160
		TPR repeat	81..111	CDD:276809
		TPR repeat	116..146	CDD:276809
		TPR 3	117..150
		TPR_11	121..180	CDD:290150
		TPR 4	154..187
		TPR repeat	154..180	CDD:276809
		TPR_12	232..302	CDD:290160
		TPR 5	236..271
		TPR repeat	238..264	CDD:276809
		TPR_12	271..345	CDD:290160
		TPR 6	273..306
		TPR	273..302	CDD:197478
		TPR repeat	273..301	CDD:276809
		TPR repeat	312..342	CDD:276809
		TPR 7	313..346
		TPR_12	314..385	CDD:290160	5/18 (28%)
		TPR 8	353..386		6/19 (32%)
		TPR repeat	353..381	CDD:276809	5/14 (36%)
		TPR_1	353..>380	CDD:278916	5/13 (38%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	418..481		22/70 (31%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	548..582
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900