DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and DNAAF4

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_570722.2 Gene:DNAAF4 / 161582 HGNCID:21493 Length:420 Species:Homo sapiens


Alignment Length:273 Identity:76/273 - (27%)
Similarity:116/273 - (42%) Gaps:66/273 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VQIS-----QTEEDIKISIELNRLVTRKPDVVLLPQYLKFNNPPIFFERHLAQEIDEMASFCRIF 61
            :|:|     ||:..:.:|:.|..:..|..||.....|||.|.||..||..|...||:.:|..:|.
Human     3 LQVSDYSWQQTKTAVFLSLPLKGVCVRDTDVFCTENYLKVNFPPFLFEAFLYAPIDDESSKAKIG 67

  Fly    62 KNEARIVLVKKEKGLW---------PEMFQKLDKEALMQ---------------KR------LEI 96
            .:.....|.|||..:|         .||.|::.:::::|               ||      |.:
Human    68 NDTIVFTLYKKEAAMWETLSVTGVDKEMMQRIREKSILQAQERAKEATEAKAAAKREDQKYALSV 132

  Fly    97 ADLIVERNKKRDE-----------KALERY-DNKRRAEIQKEIQRETDMRERVKQFQENSVREAL 149
            ...|.|..:|:.|           ||||.: :.:|:||.||:||||..:.::.||.:|.      
Human   133 MMKIEEEERKKIEDMKENERIKATKALEAWKEYQRKAEEQKKIQREEKLCQKEKQIKEE------ 191

  Fly   150 VVDVRKEAK---ATPKPDTLQYPPSSGGASRLAT-PLMRPPMSSVRGSGRINVNFTTQHKRVTPK 210
                ||:.|   .|....:....|....:..:.| .|....:.:.|..|.|.:|||   .||.|.
Human   192 ----RKKIKYKSLTRNLASRNLAPKGRNSENIFTEKLKEDSIPAPRSVGSIKINFT---PRVFPT 249

  Fly   211 --RESQAAMEKAY 221
              ||||.|.|:.:
Human   250 ALRESQVAEEEEW 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 27/90 (30%)
DNAAF4NP_570722.2 Mediates interaction with ESR1 and STUB1. /evidence=ECO:0000269|PubMed:19423554 7..103 28/95 (29%)
p23_DYX1C1_like 10..87 CDD:107226 25/76 (33%)
TPR_11 289..353 CDD:290150
TPR 1 290..323
TPR repeat 290..318 CDD:276809
TPR repeat 323..353 CDD:276809
TPR 2 324..357
TPR repeat 364..394 CDD:276809
TPR 3 366..399
TPR_1 367..399 CDD:278916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5337
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105298
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.