DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and TOMM34

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_006800.2 Gene:TOMM34 / 10953 HGNCID:15746 Length:309 Species:Homo sapiens


Alignment Length:213 Identity:37/213 - (17%)
Similarity:77/213 - (36%) Gaps:61/213 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISQTEEDIKISIE-LNRLV------------TRKPDVVLLP--QYLKFNNPPIFFERHLAQEIDE 53
            :.|.::::..::| :||:.            .:.|.:.|:|  ...::|:.|....:.:|:...:
Human   111 VLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSK 175

  Fly    54 MASF-------------CRIFKNEARIVLVKKEKGLWPEMFQKLDKEALMQKRLEIAD------- 98
            ..:.             .|:.|.|.. .|||  ||...:..:|. .|:|:...||.|.       
Human   176 ETTATKNRVPSAGDVEKARVLKEEGN-ELVK--KGNHKKAIEKY-SESLLCSNLESATYSNRALC 236

  Fly    99 -LIVERNKKRDEKALE--RYDNKRRAEIQKEIQRETDMRERVKQFQENSVREALVVDVRKEAKAT 160
             |::::..:..:...|  :.|.|......:..|....:::....|.:.|                
Human   237 YLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADIS---------------- 285

  Fly   161 PKPDTLQYPPSSGGASRL 178
               :.||..|.:|.|.:|
Human   286 ---NLLQIEPRNGPAQKL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 18/104 (17%)
TOMM34NP_006800.2 TPR 1 9..42
TPR repeat 9..37 CDD:276809
PLN03088 <12..>294 CDD:330826 34/205 (17%)
TPR repeat 50..80 CDD:276809
TPR 2 51..84
TPR repeat 85..113 CDD:276809 0/1 (0%)
TPR 3 86..118 1/6 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..189 2/27 (7%)
TPR 4 193..226 11/36 (31%)
TPR repeat 193..221 CDD:276809 10/31 (32%)
TPR repeat 226..256 CDD:276809 4/29 (14%)
TPR 5 227..260 4/32 (13%)
TPR repeat 261..289 CDD:276809 3/46 (7%)
TPR 6 262..294 6/50 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.