DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and ttc32

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001020691.1 Gene:ttc32 / 100004012 ZFINID:ZDB-GENE-041014-158 Length:136 Species:Danio rerio


Alignment Length:40 Identity:11/40 - (27%)
Similarity:18/40 - (45%) Gaps:14/40 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 EKALERYDNK--RRAEIQKEIQRETDMRERVKQFQENSVR 146
            :||.|.:::|  :|||            |...||.|:..:
Zfish    10 QKAHEEFNSKNYKRAE------------ELYTQFIESCTK 37

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226
ttc32NP_001020691.1 TPR_11 9..77 CDD:290150 11/40 (28%)
TPR repeat 9..33 CDD:276809 10/34 (29%)
TPR repeat 46..76 CDD:276809
TPR_11 47..112 CDD:290150
TPR repeat 81..109 CDD:276809
TPR_1 84..114 CDD:278916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.