DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6230 and LOC101885086

DIOPT Version :9

Sequence 1:NP_609490.1 Gene:CG6230 / 34546 FlyBaseID:FBgn0027582 Length:1225 Species:Drosophila melanogaster
Sequence 2:XP_005174520.3 Gene:LOC101885086 / 101885086 -ID:- Length:248 Species:Danio rerio


Alignment Length:234 Identity:79/234 - (33%)
Similarity:131/234 - (55%) Gaps:33/234 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 SDELLPGDLVSITRSQNDNIVPCDLVILRGSCIVDESMLTGESVPLMKESLESLDNLDVEMDAEG 384
            |.:|:|||::.|  ..|..|:|||.|::.|:|||:||||||||||:.|..|.     :.|.|.:|
Zfish    28 STDLVPGDVIVI--PSNGTIMPCDAVLICGTCIVNESMLTGESVPVTKTDLP-----NPERDKKG 85

  Fly   385 -DG---------KLFVLFGGTKVVQHTAPTKESLRAPDGGCIGYVIRTGFNTSQGKLLRTILFGA 439
             ||         |...||.||.|:|....|.|.::|       .|:||||:|::|:|:|:||:  
Zfish    86 SDGDQIYSTEEHKRHTLFCGTNVIQTRYYTGEMVKA-------VVVRTGFSTAKGQLIRSILY-- 141

  Fly   440 NRATENNVETFAFIAFLMVFAVAAASYVWVKG----SEDPERNRYKLFLECTLILTSIIPPDLPI 500
            .:.|:..:...|::..|.:.|||:..:::...    :::|.:   ::.::...|:|..:||.||.
Zfish   142 PKPTDFKLYRDAYLFLLCLVAVASVVFIYSLVMKILNQEPVK---EIIVKSLDIITITVPPALPA 203

  Fly   501 ELTLAVNTSLIQLTKLFVFCTEPFRIPFAGKVQICCFDK 539
            .:|..:..:..:|.|:.:|...|.||...|::.:.||||
Zfish   204 AMTAGIVYAQRRLRKVGIFSISPQRINICGQLNLVCFDK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6230NP_609490.1 P-ATPase-V 109..1193 CDD:273738 79/234 (34%)
E1-E2_ATPase 310..515 CDD:278548 69/208 (33%)
Cation_ATPase <590..664 CDD:289987
COG4087 <850..901 CDD:226572
LOC101885086XP_005174520.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D172453at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.