DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6230 and LOC100334666

DIOPT Version :9

Sequence 1:NP_609490.1 Gene:CG6230 / 34546 FlyBaseID:FBgn0027582 Length:1225 Species:Drosophila melanogaster
Sequence 2:XP_002667266.4 Gene:LOC100334666 / 100334666 -ID:- Length:272 Species:Danio rerio


Alignment Length:259 Identity:68/259 - (26%)
Similarity:123/259 - (47%) Gaps:63/259 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   566 EKAEGNT------VQVLACCHSLALLDDGLVGDPLEKATLAAVDWTLTKM--------------- 609
            |:|:..:      |..:|.||||..::..|.||||:.....|..|.|.:.               
Zfish    17 ERADDKSLVTSRFVSCMATCHSLTKIEGQLSGDPLDLKMFEATGWILVEATEEETAHHDRIELTY 81

  Fly   610 ----DSVIPKRPQFKP-----------------LKIIQRYHFSSALKRMSVLAGHLIPYSNEVKH 653
                :.::|. |...|                 :.|::::.|||||:||||:          |:.
Zfish    82 VKPPNQLLPP-PVISPEQDMELSELYELSASYMIGIVRQFSFSSALQRMSVV----------VRQ 135

  Fly   654 IGA------VKGAPEVIQKMLRE--VPADYEKVYLEYARRGARVLALGIKDL-GTLGAQRVREMK 709
            ||.      :||||||:..:.::  ||.|:.:|..:|.::|.||:||..:.| ..|...:|:.:.
Zfish   136 IGERRMDAYLKGAPEVVASLCKKESVPEDFAEVLEDYTKQGFRVIALAHRRLESKLTFHKVQNIN 200

  Fly   710 REEVECDLTFAGFLIISCPMKPDSKSVIKELIQSSHKVVMITG-DSPLTACHVARELRFTRKKL 772
            |:::|.::.|.|.:::...:|.::..|:.:|.:::.:.||:|| .:.|.:|...|...|.|:.|
Zfish   201 RDQIEKNMDFLGLIVMQNKLKTETPGVLDDLRRANIRTVMVTGTGNILHSCLFRRPCLFRRQFL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6230NP_609490.1 P-ATPase-V 109..1193 CDD:273738 68/259 (26%)
E1-E2_ATPase 310..515 CDD:278548
Cation_ATPase <590..664 CDD:289987 28/115 (24%)
COG4087 <850..901 CDD:226572
LOC100334666XP_002667266.4 HAD_like <1..>248 CDD:328728 62/241 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D172453at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.