DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr32a and Gr63a

DIOPT Version :9

Sequence 1:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster


Alignment Length:522 Identity:101/522 - (19%)
Similarity:167/522 - (31%) Gaps:196/522 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PTQKTRSHPYPRRISPYRPPVLNRDAFSRDAPPMPARN------HDHPVFE------DIRTILSV 63
            |.....:..|...:..|...:..|.....:|||:..:.      .::|.|:      :|..|...
  Fly    19 PLNSANAQAYLYGVRKYSIGLAERLDADYEAPPLDRKKSSDSTASNNPEFKPSVFYRNIDPINWF 83

  Fly    64 LKASGLMPIYEQVSDYEVGPPTKTNEFYS--------FFV------------------------- 95
            |:..|::||...      ||.....|..|        |||                         
  Fly    84 LRIIGVLPIVRH------GPARAKFEMNSASFIYSVVFFVLLACYVGYVANNRIHIVRSLSGPFE 142

  Fly    96 RGVVHALTIFNVYS-LFTPISAQLFFSYRETDNV-NQW-------------------------IE 133
            ..|:..|.:.|:.. :..||   |::..|:...: |.|                         |.
  Fly   143 EAVIAYLFLVNILPIMIIPI---LWYEARKIAKLFNDWDDFEVLYYQISGHSLPLKLRQKAVYIA 204

  Fly   134 LLLCILTYTLTVFVCAHNTTSMLRIMNEILQ---LDEEVRRQFGANLSQNFG---FLVKFLVGIT 192
            ::|.||: .|:| |..|.|.|.|.| |:::.   ||         ||:...|   ||:       
  Fly   205 IVLPILS-VLSV-VITHVTMSDLNI-NQVVPYCILD---------NLTAMLGAWWFLI------- 250

  Fly   193 ACQAYIIVLKIYAVQGEITPTSYILLAFYGIQNGLTATYIVFASALLRIVYIRFHFINQLLNGYT 257
             |:|..|...:.|.:                          |..||                   
  Fly   251 -CEAMSITAHLLAER--------------------------FQKAL------------------- 269

  Fly   258 YGQQHRRKEGGARARRQRGDVNPNVNPALMEHFPEDSLFIYRMHNKLLRIYKGINDCCNLILVSF 322
                                  .::.||.|       :..||:  ..||:.|...|..|.:..:|
  Fly   270 ----------------------KHIGPAAM-------VADYRV--LWLRLSKLTRDTGNALCYTF 303

  Fly   323 LG---YSFYTVTTNCYNLFVQITGKGMVSPNI-LQWCFAWLCLHVSLLALLSRSCGLTTTEANAT 383
            :.   |.|:.:|.:.|.|..|:: :|....:| |.....|   ::.||..:.......:......
  Fly   304 VFMSLYLFFIITLSIYGLMSQLS-EGFGIKDIGLTITALW---NIGLLFYICDEAHYASVNVRTN 364

  Fly   384 SQ---ILARVYAKSKEYQNIIDKFLTKSIKQEVQFTAYGFFAIDNSTLFK-IFSAVTTYLVILIQ 444
            .|   ::..:...:.:.|..|:.||..:..........|||.: |.|||| :.:.:.||||:|:|
  Fly   365 FQKKLLMVELNWMNSDAQTEINMFLRATEMNPSTINCGGFFDV-NRTLFKGLLTTMVTYLVVLLQ 428

  Fly   445 FK 446
            |:
  Fly   429 FQ 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr32aNP_523543.3 7tm_7 57..449 CDD:285581 92/464 (20%)
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 91/462 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.