DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr32a and Gr59e

DIOPT Version :9

Sequence 1:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster


Alignment Length:160 Identity:36/160 - (22%)
Similarity:61/160 - (38%) Gaps:30/160 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 IYRMHNK-LLRIYKGINDCCNLILVSFLGYSFYTVTTNCYNLFVQITGKGMVSPNILQWCFAWLC 360
            |.::|:: |||.        .|.||..|..|..::....|.:|............:|.:...||.
  Fly   237 IEQVHSQFLLRF--------GLYLVLNLLNSLVSICVELYLIFNFFETPLWEESVLLVYRLLWLA 293

  Fly   361 LHVSLL--------ALLSRSCGLTTTEANATSQILARVYAKSKEYQNIIDKF---LTKSIKQEVQ 414
            :|...:        .:|.:.|.|        .|:|..:...|...|..|::|   |.:||.|.::
  Fly   294 MHGGRIWFILSVNEQILEQKCNL--------CQLLNELEVCSSRLQRTINRFLLQLQRSIDQPLE 350

  Fly   415 FTAYGFFAIDNSTLFKIFSAVTTYLVILIQ 444
              |.|...:|..:|......:...::.|||
  Fly   351 --ACGIVTLDTRSLGGFIGVLMAIVIFLIQ 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr32aNP_523543.3 7tm_7 57..449 CDD:285581 36/160 (23%)
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 36/160 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.