DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr32a and Gr8a

DIOPT Version :9

Sequence 1:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster


Alignment Length:427 Identity:80/427 - (18%)
Similarity:141/427 - (33%) Gaps:143/427 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 GPPTKTNEFYSFFVRGVVHALTIFNVYSLFTPISAQLF----FSYRETDNVNQWIELLLCILTYT 142
            |.|.:|        |..:.|.::|.:.||...:.|.||    |.||.                  
  Fly    30 GNPART--------RRRLMAWSLFLLISLSALVLACLFSGEEFLYRG------------------ 68

  Fly   143 LTVFVCAHNT-------TSMLRIMNEILQLDEEVRR------QFG------ANLSQNFGFLVKFL 188
             .:|.||::.       ..:|.|..|.|.....:..      :.|      .:|...|....::|
  Fly    69 -DMFGCANDALKYVFAELGVLAIYLETLSSQRHLANFWWLHFKLGGQKTGLVSLRSEFQQFCRYL 132

  Fly   189 VGITACQAYIIVLKIYAVQGEITPTSYILLAFYGIQNGLTATY--IVFASALLRIVYI-RFHFIN 250
            :.:.|..|..:.:.:...|.:.. |.::||.:        :||  :|:.:.|..:.:: ....:.
  Fly   133 IFLYAMMAAEVAIHLGLWQFQAL-TQHMLLFW--------STYEPLVWLTYLRNLQFVLHLELLR 188

  Fly   251 QLLNGYTYGQQHRRKEGGARARRQRGDVNPNVNPALMEHFPEDSLFIYRMHNKLLRIYKGINDCC 315
            :.|.|.       .:|.|..|...|......      ..||....|:.|...:..|||..:.|..
  Fly   189 EQLTGL-------EREMGLLAEYSRFASETG------RSFPGFESFLRRRLVQKQRIYSHVYDML 240

  Fly   316 N-------------LILVS--------FLGYSFY-TVTTNCYNLFVQITGKGMVSPNILQWCFAW 358
            .             |:.::        |:.||.| .|..|.|.|.|         |.:|:     
  Fly   241 KCFQGAFNFSILAVLLTINIRIAVDCYFMYYSIYNNVINNDYYLIV---------PALLE----- 291

  Fly   359 LCLHVSLLALLSRSCGLTTTEANATSQILARVYAKSKEYQNI---------------IDKFLTKS 408
                :......|:||.:          ::.|:   :.:..||               |..|..:.
  Fly   292 ----IPAFIYASQSCMV----------VVPRI---AHQLHNIVTDSGCCSCPDLSLQIQNFSLQL 339

  Fly   409 IKQEVQFTAYGFFAIDNSTLFKIFSAVTTYLVILIQF 445
            :.|.::....|...:|.|.|.::..:|.||::..|||
  Fly   340 LHQPIRIDCLGLTILDCSLLTRMACSVGTYMIYSIQF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr32aNP_523543.3 7tm_7 57..449 CDD:285581 80/427 (19%)
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 78/425 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.