DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr32a and Gr22c

DIOPT Version :9

Sequence 1:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster


Alignment Length:352 Identity:72/352 - (20%)
Similarity:132/352 - (37%) Gaps:108/352 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 TYTLTVFVCA--H-----NTTSMLRIMNEILQLDEEVRRQFGANLSQNFGFLVKFLVGITACQAY 197
            |..|.||.|.  |     .:|.:..:.||:|.|:.:   || |:|::            |.|..:
  Fly    89 TGMLAVFSCVVIHFLNFWGSTRVQDLANELLVLEYQ---QF-ASLNE------------TKCPKF 137

  Fly   198 --IIVLKIYAVQGEITPTSYILLAFYGIQNGLTATYIVFASALLRIVYIRFHFINQLLNGYTYGQ 260
              .::.|..:|.|.:  .||:.:| ||:.....:..:|..::|     ::|.|            
  Fly   138 NSFVIQKWLSVIGLL--LSYLSIA-YGLPGNNFSVEMVLINSL-----VQFSF------------ 182

  Fly   261 QHRRKEGGARARRQRGDVNPNVNPALMEHFPEDSLFIYR----MHNKLLRIYKGINDCCNL---- 317
                                |.|   :.|:....|.|||    ::.:||.:...:...|::    
  Fly   183 --------------------NCN---IMHYYIGVLLIYRYLWLINGQLLEMVTNLKLDCSVDSSR 224

  Fly   318 ------ILVSFLGYSFYTVTTNCYNLFVQITGKGMVSPNILQWCFAWLCLHVSL----------- 365
                  :....|....|.|.|..|::.:.:| .|:.| |.|. .::|:.|.:|:           
  Fly   225 IRKYLSLYRRLLELKGYMVATYEYHMTLVLT-TGLAS-NFLA-IYSWIVLDISMNINFIYLLIFP 286

  Fly   366 LAL--------LSRSCGLTTTEANATSQILARVYA----KSKEYQNIIDKFLTKSIKQEVQFTAY 418
            |.|        ||.:.......|..::|.:.:::|    |..|.:..:::|.......:..|...
  Fly   287 LFLLVNVWNLWLSIAASDLAENAGKSTQTVLKLFADLEVKDIELERSVNEFALLCGHCQFNFHVC 351

  Fly   419 GFFAIDNSTLFKIFSAVTTYLVILIQF 445
            |.|.|:....|::......||:.:|||
  Fly   352 GLFTINYKMGFQMIITSFLYLIYMIQF 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr32aNP_523543.3 7tm_7 57..449 CDD:285581 72/352 (20%)
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 72/352 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450264
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.