DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr32a and Gr22b

DIOPT Version :9

Sequence 1:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001014456.1 Gene:Gr22b / 117492 FlyBaseID:FBgn0045500 Length:386 Species:Drosophila melanogaster


Alignment Length:383 Identity:75/383 - (19%)
Similarity:153/383 - (39%) Gaps:97/383 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 IFNVYSLFTPISAQLFFSYR----ETDNVNQWIEL------LLCILTYTLTVFVCAHNTTSMLRI 158
            :.|.:.:||.|  :|.|.||    |....|..:|:      ::.:|:..:..|:....:..:..|
  Fly    55 VLNYFLIFTLI--RLAFEYRKHKLEAFKRNPVLEMINVVIGIINVLSALIVHFMNFWGSRKVGEI 117

  Fly   159 MNEILQLDEEVRRQFGANLSQNFGFLVKFLVGITACQAYIIVLKIYAVQGEITPTSYILLAFYGI 223
            .||:|.|:.:...........||.           |   .::.|...:.|:       ||:|:.:
  Fly   118 CNELLILEYQDFEGLNGRNCPNFN-----------C---FVIQKCLTILGQ-------LLSFFTL 161

  Fly   224 QNGLTA----TYIVFASAL----LRIVYIRFHFINQLLNGYTYGQQHRRKEGGARARRQRGDVNP 280
            ...|..    ..:|..|.|    |.:..:.:|....|:..|.:....:.|:..::.:     :||
  Fly   162 NFALPGLEFHICLVLLSCLMEFSLNLNIMHYHVGVLLIYRYVWLINEQLKDLVSQLK-----LNP 221

  Fly   281 NVNPALMEHFPEDSLFIYR----MHNKLLRIYK------------GINDCCNLILVSFLGYSFYT 329
            ..:.:.:..|    |.:|:    ::.||:..|:            |     |::::.||  ..|.
  Fly   222 ETDFSRIHQF----LSLYKRLLELNRKLVIAYEYQMTLFIIAQLSG-----NIVVIYFL--IVYG 275

  Fly   330 VTTNCYNLFVQITGKGMVSPNILQ---WCFAWLCLHVSLLALLSRSCGLTTTEANATSQILARVY 391
            ::...|::|:      :..||.|.   |.| |||:         .:|.||....:.|: |:.:::
  Fly   276 LSMRTYSIFL------VAFPNSLLINIWDF-WLCI---------AACDLTEKAGDETA-IILKIF 323

  Fly   392 A----KSKEYQNIIDKFLTKSIKQEVQFTAYGFFAIDNSTLFKIFSAVTTYLVILIQF 445
            :    :..:.:..:::|......::.:|...|.|:::....||:......|||.|:||
  Fly   324 SDLEHRDDKLEMSVNEFAWLCSHRKFRFQLCGLFSMNCRMGFKMIITTFLYLVYLVQF 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr32aNP_523543.3 7tm_7 57..449 CDD:285581 75/383 (20%)
Gr22bNP_001014456.1 7tm_7 17..385 CDD:285581 75/383 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.