DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr32a and Gr36a

DIOPT Version :9

Sequence 1:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster


Alignment Length:395 Identity:73/395 - (18%)
Similarity:142/395 - (35%) Gaps:91/395 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RGVVHALTIFNVYSLFTPISAQLFFSYRETDNVNQWIELLLCILTYTLTVFVCAHNTTSMLRIMN 160
            ||::.|:.| ||.     |...|.....:..|::.:......:..|.:.|.|.....:.:..|:|
  Fly    38 RGILFAIAI-NVL-----ICMVLLLQISKKFNLDVYFGRANQLHQYVIIVMVSLRMASGISAILN 96

  Fly   161 ------EILQLDEEVRRQF----GANLSQNFGFLVKFLVGITACQAYIIVLKIYAVQGEITPTSY 215
                  ::::|.|.|.|.|    .......:..||||.||:.:          ..:|..|:..|.
  Fly    97 RWRQRAQLMRLVECVLRLFLKKPHVKQMSRWAILVKFSVGVVS----------NFLQMAISMESL 151

  Fly   216 ILLAFYGIQNGLTATYIVFASALLRIVYIRFHFINQLLNGYTYGQQHRRKEGGARARRQRGDVNP 280
            ..|.|.... |:.:.:  :.||::.:...:.:.:...:..|    .|..|....:|..:      
  Fly   152 DRLGFNEFV-GMASDF--WMSAIINMAISQHYLVILFVRAY----YHLLKTEVRQAIHE------ 203

  Fly   281 NVNPALMEHFPEDSLF-------------IYRMHNKLLRIYKGINDCCNL--ILVSFLGYSFYTV 330
              :..|.|.:|..:.|             |.::.|:|..|...:|....:  |:| :.||..::|
  Fly   204 --SQMLSEIYPRRAAFMTKCCYLADRIDNIAKLQNQLQSIVTQLNQVFGIQGIMV-YGGYYIFSV 265

  Fly   331 TTN--CYNLFVQITGKGMVSPNILQWCFAWLCLHVSLLALLSRSCGLTTTEANATSQILARVYAK 393
            .|.  .|:|.:....:..:|.......|:|...:.              |.|.....::.:::..
  Fly   266 ATTYITYSLAINGIEELHLSVRAAALVFSWFLFYY--------------TSAILNLFVMLKLFDD 316

  Fly   394 SKEYQNI----------IDKFLTKS--------IKQEVQFTAYGFFAIDNSTLFKIFSAVTTYLV 440
            .||.:.|          :|..|.:|        |:..::......|.|..|:...:..::.|..:
  Fly   317 HKEMERILEERTLFTSALDVRLEQSFESIQLQLIRNPLKIEVLDIFTITRSSSAAMIGSIITNSI 381

  Fly   441 ILIQF 445
            .|||:
  Fly   382 FLIQY 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr32aNP_523543.3 7tm_7 57..449 CDD:285581 73/395 (18%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 73/395 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.