DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr32a and Gr59a

DIOPT Version :9

Sequence 1:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster


Alignment Length:387 Identity:64/387 - (16%)
Similarity:131/387 - (33%) Gaps:115/387 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 VYSLFTPISAQLFFSYRETDNVNQWI-------ELLLCILTY---TLTVFVCAHNTTSMLRIMNE 161
            :.::|..:....|:...:..:...|:       ..::|.:.|   ..|:....:....::.:...
  Fly    40 INAIFLTLLPSAFWKSAKLLSTADWMPSYMRVTPYIMCTINYAAIAYTLISRCYRDAMLMDLQRI 104

  Fly   162 ILQLDEEVRR---QFGANLSQNFGFLVKFLVGITACQAYIIVLKIYAVQGEITPTSYILLAFYGI 223
            :|:::.|:.|   :..:.|.:.| ||..|.: ..:|.:||:.:.||..:.:         .:..:
  Fly   105 VLEVNREMLRTGKKMNSLLRRMF-FLKTFTL-TYSCLSYILAVFIYQWKAQ---------NWSNL 158

  Fly   224 QNGLTA----------TYIVFASALLRIVYIRFHFINQLLNGYTYGQQH--RRKEGGAR------ 270
            .|||..          |:..|.|  |..:...:.|:||.||.....|..  .||....|      
  Fly   159 CNGLLVNISLTILFVNTFFYFTS--LWHIARGYDFVNQQLNEIVACQSMDLERKSKELRGLWALH 221

  Fly   271 ------ARRQRGDVNPNVNPALM----EHFPEDSLFIYRMHNKLLRIYKGINDCCNLILVSFLGY 325
                  |||    :|.:..|.::    ::|                |:..||.|...|      |
  Fly   222 RNLSYTARR----INKHYGPQMLAMRFDYF----------------IFSIINACIGTI------Y 260

  Fly   326 SFYTVTTNCYNLFVQITGKGMVSPNILQWCFA-------WLCLHVSLLALLSRSCGLTTTEANAT 383
            |    ||:......:|.|      :::.|..:       ::|..||                  .
  Fly   261 S----TTDQEPSLEKIFG------SLIYWVRSFDFFLNDYICDLVS------------------E 297

  Fly   384 SQILARVYAKSKEYQNIIDKFLTKSIKQEVQFTAYGFFAIDNSTLFKIFSAVTTYLVILIQF 445
            .|:..:.:|......|.:..:|.......:.....|.:.::.....::..::..:..:|.||
  Fly   298 YQMQPKFFAPESSMSNELSSYLIYESSTRLDLLVCGLYRVNKRKWLQMVGSIVVHSSMLFQF 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr32aNP_523543.3 7tm_7 57..449 CDD:285581 64/387 (17%)
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 64/387 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.