DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr32a and Gr59b

DIOPT Version :9

Sequence 1:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_523818.2 Gene:Gr59b / 117484 FlyBaseID:FBgn0045482 Length:366 Species:Drosophila melanogaster


Alignment Length:411 Identity:88/411 - (21%)
Similarity:141/411 - (34%) Gaps:134/411 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 FYSFFVRGVVHALTIFNVYSL-FTPI---SAQLFFSYRE--------TDNVNQWIELLLCILTYT 142
            |.:.|.|  .:|| |.|:.:| ..||   ..||.|..::        |:||.:.:..|  ::.| 
  Fly    29 FSTLFSR--TYAL-IANIVTLIMLPIVMWQVQLVFQQKKTFPKLILITNNVREAVSFL--VILY- 87

  Fly   143 LTVFVCAHNTTSMLRIMNEILQLDEEVRRQFGANLSQNFGFLVKFLVGITACQAYIIVLKIYAVQ 207
             ||.......|:...:...:|.|..|.:|         .||  |.:.|:......::.:|.:.: 
  Fly    88 -TVLSRGFRDTAFKEMQPLLLTLFREEKR---------CGF--KGIGGVRRSLRILLFVKFFTL- 139

  Fly   208 GEITPTSYILLAFYGIQNGLTATYIVF----ASALLRIVYIRFHF---INQLLN----GYTYGQQ 261
                             :.|..|.::|    ..||:.:..:||.|   .|.:|.    ||.....
  Fly   140 -----------------SWLCVTDVLFLLYSTDALIWVNVLRFFFKCNTNNILEMVPMGYFLALW 187

  Fly   262 H---------RR-----KEGGARARRQRGDVNPNVNPALMEHFPEDSLFIYRMHNKLLRIYKGIN 312
            |         ||     |....|..|:            ::|       ::.:|..|.:....||
  Fly   188 HIARGFDCVNRRLDQIVKSKSTRKHRE------------LQH-------LWLLHACLTKTALNIN 233

  Fly   313 DCCNLILVSFLGYSFYTVTTNCYNLFVQITGKGMVSPNILQWCFAWLC-----LHVSLL--ALLS 370
               .:.....|...|    .|..|..:|... |.|....|...|.|:.     .||..|  .|:.
  Fly   234 ---KIYAPQMLASRF----DNFVNGVIQAYW-GAVFTFDLSTPFFWVVYGSVQYHVRCLDYYLID 290

  Fly   371 RSCGLTT----------TEANATSQILARV-YAKSKEYQNIIDKFLTKSIKQEVQFTAYGFFAID 424
            ..|.:..          :|...|.:|.:.| ||.|           ||     :|..:.|.|..:
  Fly   291 NMCDVAVEYHDSAKHSWSEVRWTKEISSYVIYANS-----------TK-----LQLWSCGLFQAN 339

  Fly   425 NSTLFKIFSAVTTYLVILIQF 445
            .|..|.:.|:|..|:::|:||
  Fly   340 RSMWFAMISSVLYYILVLLQF 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr32aNP_523543.3 7tm_7 57..449 CDD:285581 88/411 (21%)
Gr59bNP_523818.2 7tm_7 6..364 CDD:285581 88/411 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.