DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr32a and Gr93b

DIOPT Version :9

Sequence 1:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster


Alignment Length:347 Identity:70/347 - (20%)
Similarity:136/347 - (39%) Gaps:68/347 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 FFSYRETDNVNQWIELLLCILTYTLTVFVCAHNTTSMLRIMNEILQLDEEVRRQFGANLSQN-FG 182
            ||.:|          |:.|::...:.:.:.......::.::|..|||..  |.|...|..:| ||
  Fly    90 FFGFR----------LIGCLICSVIILVMQFWFGEELINLVNRFLQLFR--RMQSLTNSPKNRFG 142

  Fly   183 FLVKFLVGITACQAYIIVLKIYAVQGEITPTSYILLA---FYGIQNGLTATYIVFASALLRIVYI 244
            ...:||:..:...:.:.|...:.:.  ::|...:.|.   :..:..|: .|::.|      :.|:
  Fly   143 DRAEFLLMFSKVFSLLFVFMAFRLM--LSPWFLLTLVCDLYTSVGTGM-ITHLCF------VGYL 198

  Fly   245 RFHFINQLLNGYTYGQ---QHRRKEGGARARRQRGDVNPNVNPALMEHFPEDSLFIYRMHNKLLR 306
            ....:.:.||.|...|   |.|...|...:.|.    ||......:.:. :..|::|...:::.|
  Fly   199 SIGVLYRDLNNYVDCQLRAQLRSLNGENNSFRN----NPQPTRQAISNL-DKCLYLYDEIHQVSR 258

  Fly   307 IYKGIND-------CCNLILVSFLGYSFYTVTTNCYNLFVQITGKGMVSPNILQWCFAWLCLHVS 364
            .::.:.|       ..:|:.:|.:.|.........:||:      |:|..         |.:.|.
  Fly   259 SFQQLFDLPLFLSLAQSLLAMSMVSYHAILRRQYSFNLW------GLVIK---------LLIDVV 308

  Fly   365 LLALLSRSCGLTTTEANATSQILARV------YAKSKEYQNIIDKFLTKSIKQEVQFTAYGFFAI 423
            ||.:...|       |...|:::.|:      ...|:.|...::.||.:...||::....|.|.:
  Fly   309 LLTMSVHS-------AVNGSRLIRRLSFENFYVTDSQSYHQKLELFLGRLQHQELRVFPLGLFEV 366

  Fly   424 DNSTLFKIFSAVTTYLVILIQF 445
            .|.......||:.||||.|:|:
  Fly   367 SNELTLFFLSAMVTYLVFLVQY 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr32aNP_523543.3 7tm_7 57..449 CDD:285581 70/347 (20%)
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 70/347 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.