DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr32a and Gr22f

DIOPT Version :9

Sequence 1:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster


Alignment Length:404 Identity:81/404 - (20%)
Similarity:149/404 - (36%) Gaps:131/404 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 YSFFVRGVVHALTIF------------NVYSLF--TPISAQLFFSYRETDNVNQWIELLLCILTY 141
            |.|    |:|:|.:.            ..|:.|  .|:..:::..::.|           ...|.
  Fly    52 YGF----VLHSLAMCLAMSSHLASKQRRKYNAFERNPLLEKIYMQFQVT-----------TFFTI 101

  Fly   142 TLTVFVCAHNTTSMLRIMNEILQLDEEVRRQFGANLSQNFG-FLVK--------FLVGITAC--- 194
            ::.:.:....:.::.:|.||:|.|:.:|:.........||. |::|        |::.|..|   
  Fly   102 SVLLLMNVWKSNTVRKIANELLTLEGQVKDLLTLKNCPNFNCFVIKKHVAAIGQFVISIYFCLCQ 166

  Fly   195 -QAYIIVLKIYAVQGEITPTSYILLAFYGIQNGLTATYIVFASALLRIVYIRFHFINQLLNGYTY 258
             .:|..:|||..           .|...|:|                  .|..||..:::..|.|
  Fly   167 ENSYPKILKILC-----------CLPSVGLQ------------------LIIMHFHTEIILVYRY 202

  Fly   259 GQQHRRKEGGARARRQRGDVNPNVNPALMEHFPEDS--LFIYRMH------NKLLRIYKGINDCC 315
            ...                    ||..|     |||  |...|:|      ::||::.:.:..|.
  Fly   203 VWL--------------------VNETL-----EDSHHLSSSRIHALASLYDRLLKLSELVVACN 242

  Fly   316 NLILVSFLGYSFYTVTTNCYNLFVQITGKGM--------VSPNIL--QWCFAWLCLHVSLLALLS 370
            :|.|:..|  ..|.:.......|:.:.|..|        .||.::  .|.| ||.:.|..||   
  Fly   243 DLQLILML--IIYLIGNTVQIFFLIVLGVSMNKRYIYLVASPQLIINFWDF-WLNIVVCDLA--- 301

  Fly   371 RSCGLTTTEANATSQILARVYA----KSKEYQNIIDKFLTKSIKQEVQFTAYGFFAIDNSTLFKI 431
            ..||      :.||::| :::.    ..:|.:..:::|......::.:|...|.|:|:::..|::
  Fly   302 GKCG------DQTSKVL-KLFTDLEHDDEELERSLNEFAWLCTHRKFRFQLCGLFSINHNMGFQM 359

  Fly   432 FSAVTTYLVILIQF 445
            ......|||.|:||
  Fly   360 IITSFLYLVYLLQF 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr32aNP_523543.3 7tm_7 57..449 CDD:285581 81/404 (20%)
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 81/404 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.