DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr32a and Gr98c

DIOPT Version :9

Sequence 1:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_524531.2 Gene:Gr98c / 117336 FlyBaseID:FBgn0046886 Length:408 Species:Drosophila melanogaster


Alignment Length:456 Identity:92/456 - (20%)
Similarity:156/456 - (34%) Gaps:146/456 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RTILSVLKASGLMPIYEQVSDYEVGPPTKTNEF-----YSFFVRGVVHALTIF-----NVYSLFT 112
            |..|.||...||.|    .:::......|...|     ||.::..::  |.:|     |:.||..
  Fly    15 RPYLQVLSLFGLTP----PAEFFTRTLRKRRRFCWMAGYSLYLIAIL--LMVFYEFHANIVSLHL 73

  Fly   113 PISAQLFFSYRETDNVNQWIELLLCILTYTLTVFVCAHNTTSMLRIM----------NEILQLDE 167
            .|     :.:.        :|....::..|....:.|..|.:.|.|:          :||..||.
  Fly    74 EI-----YKFH--------VEDFSKVMGRTQKFLIVAIATCNQLNILLNYGRLGLIYDEIANLDL 125

  Fly   168 EVRR------------QFGANLSQNFGFLVKFLVGI----TACQAYIIVLKIYAVQGEITPTSYI 216
            .:.:            .|...|:.:.|..:..::|:    |..:|...   .:.|...:|....|
  Fly   126 GIDKSSKNFCGKSHWWSFRLRLTLSIGLWMVIIIGVIPRLTLGRAGPF---FHWVNQVLTQIILI 187

  Fly   217 LLAFYGIQNGLTATYIVFASALLRIVYIRFHFINQL---LNGYTYGQQHRRKEGGARARRQRGDV 278
            :|...|.:      |.:|...:..::....|.:.||   |..:..|           ||.|...|
  Fly   188 MLQLKGPE------YCLFVLLVYELILRTRHVLEQLKDDLEDFDCG-----------ARIQELCV 235

  Fly   279 NPNVNPALMEHFPE--DSLFIY-RMHNKLLRIYKGI----------------NDCCNLILVSFLG 324
            ....|..|:.....  |.:..| |....||.:|.|:                ||||.|       
  Fly   236 TLKQNQLLIGRIWRLVDEIGAYFRWSMTLLFLYNGLTILHVVNWAIIRSIDPNDCCQL------- 293

  Fly   325 YSFYTVTTNCYNLFVQITGKGMVSPNILQWCFAWLCLHVSLLALLSRSCGLTTTEANATSQILAR 389
                       |....||   .:|.|:|..||            .|..|..|   .|:.|.||.:
  Fly   294 -----------NRLGSIT---FLSFNLLLTCF------------FSECCVKT---YNSISYILHQ 329

  Fly   390 V--YAKSKEYQNI---IDKFLTKSIKQEVQFTAYGFFAIDNSTLFKIFSAVTT----YLVILIQF 445
            :  ...::|:|.:   :.:::.:....::.||..|.|.|:    .|:|..:..    |::|::||
  Fly   330 IGCLPTAEEFQMLKMGLKEYILQMQHLKLLFTCGGLFDIN----IKLFGGMLVTLCGYVIIIVQF 390

  Fly   446 K 446
            |
  Fly   391 K 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr32aNP_523543.3 7tm_7 57..449 CDD:285581 92/456 (20%)
Gr98cNP_524531.2 7tm_7 15..393 CDD:285581 92/456 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.