DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reps and END3

DIOPT Version :9

Sequence 1:NP_609487.2 Gene:Reps / 34542 FlyBaseID:FBgn0032341 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_014315.1 Gene:END3 / 855640 SGDID:S000005028 Length:349 Species:Saccharomyces cerevisiae


Alignment Length:289 Identity:63/289 - (21%)
Similarity:97/289 - (33%) Gaps:93/289 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 SRIPVEELRHIWQLCDVTRDGALSLSEFTAAMHLV--VLRRNNIPLPTSLPHCLHPNVLQAAASG 359
            |::....|..||.|.|:..|..|...||...|.|:  ::.:|...:|..||..|.|        |
Yeast    38 SKLDSSVLNKIWFLADIDDDDNLDFEEFVICMRLIFDMVNKNISSVPDELPDWLIP--------G 94

  Fly   360 SGQGVTSSSSAALPQE----PPEADL---LHLNDDDEDDH----------TDNTIIAGNLSGSST 407
            |...:..........|    ||:.::   .:::.||.:.:          ||.||....||...:
Yeast    95 SKVNLIKERKKRKQIENADLPPKKEIKVDWYMSPDDLNQYEKIYNSCAKLTDGTITFNELSTKLS 159

  Fly   408 TS----------------KPRPNVPS-DKN-----------------------------IMNLSS 426
            |.                .|: |:|| |::                             :.|...
Yeast   160 TKFFNISKTDLNKVWSLINPQ-NLPSIDRDPTFYFIHCLRQRNDLGAEIPASLPNSLAEVCNKKQ 223

  Fly   427 IS---TSSQASNSSKREATPQNSL---GKNRSI-SNSPNVEKPVSGTVSSTASAVDS--TNVSSQ 482
            :|   .|||.....|.||...::|   |:|.|. |:..||...........||..|.  .|:..|
Yeast   224 LSYDLRSSQPPTKRKEEANEVDNLRDNGQNSSSDSSGSNVLSNEDSIKQKYASLTDDQVANMREQ 288

  Fly   483 WT-----KFSE-----SPTTSAVSVQSTT 501
            ..     |.||     |..:..::::|.|
Yeast   289 LEGLLNYKKSEKTQGGSKLSKRINIRSIT 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RepsNP_609487.2 EH 262..345 CDD:197477 14/49 (29%)
EH 270..336 CDD:238009 12/40 (30%)
END3NP_014315.1 EF-hand_4 1..104 CDD:289529 20/73 (27%)
EH 123..221 CDD:197477 14/98 (14%)
End3 186..345 CDD:403842 27/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11216
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.