DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reps and end3

DIOPT Version :9

Sequence 1:NP_609487.2 Gene:Reps / 34542 FlyBaseID:FBgn0032341 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_595720.1 Gene:end3 / 2539902 PomBaseID:SPBC11G11.02c Length:375 Species:Schizosaccharomyces pombe


Alignment Length:378 Identity:81/378 - (21%)
Similarity:143/378 - (37%) Gaps:93/378 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 PEQREYYNKQFRTVQRDPHGLLSGQAARNFFEKSRIPVEELRHIWQLCDVTRDGALSLSEFTAAM 328
            |:::..|.:.||.:..: :|.|||..|......|::..::|..||.|.|:..||.....||..||
pombe     3 PQEKNKYWEIFRGLNPE-NGYLSGSKAAGVLRSSKLSSDKLEKIWDLADIDDDGMFDFDEFAIAM 66

  Fly   329 HLVVLRRNNI--PLPTSLPHCLHPNVLQAAASGSGQGVTSSSSAALPQEPPEADLLH----LNDD 387
            .:.....|.:  .:|..:|        :|..|.|.:.:.::..|....:  :..|||    |:.|
pombe    67 KITFDLINGVYKTVPDRVP--------EALVSTSKKHLVAARDALRGND--DIALLHKVPSLDTD 121

  Fly   388 DED----DHTDNTIIAGNLSGSSTTSKPRPNVPSDKNIMNLSSISTSSQASNSSKREA----TPQ 444
            .||    |..|..|...:....|.......|...:.:...|:.:.|.....||..::|    .||
pombe   122 PEDAVLKDGFDWYISPSDKIRYSDIYSLHCNKHGEVSFNGLAPVFTPFGVPNSQIQKAWKLVNPQ 186

  Fly   445 --NSLGKNRSI---------SNS---PNVEKPVS-------GTVSSTASAVDSTNVSSQWTKFSE 488
              .::.|::.:         ||.   || :.|.|       |.:.....:.:|||      .:..
pombe   187 GTETIQKDQCLVFLHILTQRSNGFRIPN-DVPYSLKASFKRGNIDYNLDSYNSTN------NYYS 244

  Fly   489 SPTTSAVSVQSTTGAAPVVAAGAAASGASSPGLKPVLFDMKRSAQDVVSNPQILHPVPLRVTPIG 553
            |||.:    .||.||.|       .|...:|.      |::.|..:::|....|..:..::    
pombe   245 SPTMA----PSTGGAKP-------KSDLDAPR------DVRDSDWELISLRNELSKLDEKI---- 288

  Fly   554 TAIASSAESSN--ENESAVAQRE-----------------DSPKAISSTTVNN 587
            .::....:..|  :|:|.:.||:                 |.|...|::.::|
pombe   289 LSLQRETDDVNIAQNKSKLIQRDLQKVLDYKLGILQSLKNDGPNGPSASAIDN 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RepsNP_609487.2 EH 262..345 CDD:197477 23/82 (28%)
EH 270..336 CDD:238009 20/65 (31%)
end3NP_595720.1 EF-hand_4 1..101 CDD:289529 27/106 (25%)
EH 9..74 CDD:238009 20/65 (31%)
EH 132..226 CDD:197477 18/94 (19%)
End3 193..368 CDD:289527 34/177 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11216
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.