DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr59 and AT4G00070

DIOPT Version :9

Sequence 1:NP_609485.4 Gene:Wdr59 / 34540 FlyBaseID:FBgn0032339 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_191918.4 Gene:AT4G00070 / 828211 AraportID:AT4G00070 Length:179 Species:Arabidopsis thaliana


Alignment Length:169 Identity:30/169 - (17%)
Similarity:50/169 - (29%) Gaps:69/169 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   776 EKTVRLPPQLNSQISPYHTVLPLDVKSSSSSNTWQQLKQLRSNSWSDSLDLEIKQIQSDAYACSL 840
            :|..:.|..|.....||.     :::..:...|::||.||.:|...::..::...|.        
plant    74 KKLRKRPKGLRMDTDPYQ-----ELRMDTDHMTYEQLLQLCNNMGYENSGVKASNID-------- 125

  Fly   841 IRRTKMPLFDQFKRAYAEILFGWQLLSKRALILKHTQNTPPPVQGVEFVTECRKCAKPKRTPKCE 905
                                        |.|     :||.|.    ||.:...|           
plant   126 ----------------------------RCL-----RNTKPS----EFQSLADK----------- 142

  Fly   906 PCKRPVLFCVLCRLPV-KGAANACLACGHGGHIDHMMQW 943
                   .|.:|:... |.|....|.|||..|::.:..|
plant   143 -------ICCICQDGFQKRAGVGKLNCGHNFHVNCVKPW 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr59NP_609485.4 WD40 <92..343 CDD:225201
WD40 repeat 132..170 CDD:293791
WD40 repeat 178..213 CDD:293791
WD40 repeat 220..259 CDD:293791
WD40 repeat 263..306 CDD:293791
WD40 repeat 312..341 CDD:293791
mRING-H2-C3H3C2_WDR59 912..957 CDD:319606 10/33 (30%)
modified RING-H2 finger (C3H3C2-type) 914..953 CDD:319606 10/31 (32%)
AT4G00070NP_191918.4 zf-RING_2 144..179 CDD:290367 10/31 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D590848at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.