DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr59 and Pex7

DIOPT Version :9

Sequence 1:NP_609485.4 Gene:Wdr59 / 34540 FlyBaseID:FBgn0032339 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_001137914.1 Gene:Pex7 / 38994 FlyBaseID:FBgn0035922 Length:339 Species:Drosophila melanogaster


Alignment Length:321 Identity:75/321 - (23%)
Similarity:114/321 - (35%) Gaps:100/321 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LAGRGHLALQRL----------GQDDGSLRRHERQSKYEVSVAEFAICPSRKEYCAIATSQHIDI 111
            |||.|.|.|...          ||..|.|.|.|    :...:.:.|.||...:..|.|:... .:
  Fly    36 LAGGGSLFLLEQNSNTNSSSTDGQSLGELCRLE----WSDGLFDVAWCPYAADIAATASGDG-SL 95

  Fly   112 VRW---------GTAEPHYEM-SLRGHTRTVTDIDWHGK-DPNLLVSCSIDTFSHIWDLREPRKP 165
            ..|         ....|...: .|:.|...|..:||..| :.:.|:|.|.|....:||....   
  Fly    96 QIWCGLDGESASNQLTPKQPLICLQEHKNEVYSLDWGEKWNYHTLLSGSWDCTLKLWDCNRQ--- 157

  Fly   166 ALSLNAVCMSGATQVG---------FNRVSGNLLAA-AHDGDLRIWD-IRKGSCPTHYITAHLNR 219
                |::    .|.||         |:.:..||.|: :.||.|.:|: :.....|...|.||.:.
  Fly   158 ----NSI----TTFVGHNDLIYGAKFSPLIANLFASVSTDGHLNLWNSLDFAGKPLMSIEAHASE 214

  Fly   220 VHGINWSHKRETCLATASQDGTVKYFDV---------------------CNPRRAEKIITTMSPV 263
            ....:|||.....|.|...||.::.:|:                     |:|..|..:.:     
  Fly   215 ALCCDWSHFDRNVLVTGGSDGLIRGWDLRKMRTHVFELYSGEFAVRRLACSPHSAAVLAS----- 274

  Fly   264 WRARY---TPIGNGLVSIVVPHLGRGENSLLLWSNSKQTDPICSFVGHTDVILDFAWRPNR 321
              |.|   |.|.|         |.|||::..:  |::.|:.:|.        ||  |.|:|
  Fly   275 --ANYDFTTRIWN---------LERGESAQEV--NARHTEFVCG--------LD--WNPHR 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr59NP_609485.4 WD40 <92..343 CDD:225201 63/276 (23%)
WD40 repeat 132..170 CDD:293791 10/38 (26%)
WD40 repeat 178..213 CDD:293791 12/45 (27%)
WD40 repeat 220..259 CDD:293791 11/59 (19%)
WD40 repeat 263..306 CDD:293791 12/45 (27%)
WD40 repeat 312..341 CDD:293791 5/10 (50%)
mRING-H2-C3H3C2_WDR59 912..957 CDD:319606
modified RING-H2 finger (C3H3C2-type) 914..953 CDD:319606
Pex7NP_001137914.1 WD40 53..328 CDD:295369 69/304 (23%)
WD40 repeat 74..121 CDD:293791 8/47 (17%)
WD40 <85..>328 CDD:225201 60/268 (22%)
WD40 repeat 126..164 CDD:293791 12/48 (25%)
WD40 repeat 171..209 CDD:293791 9/37 (24%)
WD40 repeat 215..251 CDD:293791 8/35 (23%)
WD40 repeat 259..296 CDD:293791 12/54 (22%)
WD40 repeat 303..328 CDD:293791 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.