DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Samuel and Gmeb2

DIOPT Version :9

Sequence 1:NP_001260372.1 Gene:Samuel / 34530 FlyBaseID:FBgn0032330 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_113991.2 Gene:Gmeb2 / 83635 RGDID:620481 Length:530 Species:Rattus norvegicus


Alignment Length:406 Identity:86/406 - (21%)
Similarity:137/406 - (33%) Gaps:133/406 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   558 SPFMTNFLPFSSGIFPPLIDMSSTQALLTLA--------------------RAVKDA-------- 594
            ||..|.::|.:    |...|::.:.|.:|:.                    |.:|||        
  Rat   191 SPTSTEYIPLT----PAAADVNGSPATITIETCEDPGDWTTTIGDDTFAFWRGLKDAGLLDEVIQ 251

  Fly   595 ----EIQEILRSKQQRSGSNASSPSASAAGTPRSSSTLNAALHQAAQF-VTPALIYSAQLQQQQ- 653
                |::|.::..|||    ...|....    |.:..||..:...... :...::.|.:.|..: 
  Rat   252 EFQQELEETMKGLQQR----VQDPPLQL----RDAVLLNNIVQNFGMLDLVKKVLASHKCQMDRS 308

  Fly   654 -----------QQQQQQHQRQQQQ---QSQHASRQSSPRSTNDSTTVAPIGDGGGGSSIASAAPL 704
                       :||..:|:|:.::   :|||.|        |...|:.|:               
  Rat   309 REQYARDLAALEQQCDEHRRRAKELKHKSQHLS--------NVLMTLTPV--------------- 350

  Fly   705 DLSSQPPAAKRFKAERRASSTATTATTATTGSSTSTPSP-PPLEQHDDINSGNANATL-GTRSGT 767
               |.|...||.:..|..|..|..|:...|.|:.....| .|:.|...:..|...:|| .|..|.
  Rat   351 ---SLPSPMKRPRLARATSGPAAMASQVLTQSAQIALGPGMPMSQLTSVPLGKVVSTLPSTVLGK 412

  Fly   768 GTGESSAAGSGAGVAKARRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQSFRDQSIDGTGLPL 832
            |:.:::.|.|.|.                        ..:||..:.|.          .|:..|.
  Rat   413 GSPQAAPASSPAS------------------------PLLGGYTVLAS----------SGSTFPS 443

  Fly   833 LTEDH-------LVNSLGMKLG-PALKLRSIL-AKKLGGPCPCVACVAQAQQM-LALQTGGAAAA 887
            ..|.|       ::::..|:.| ..||:.|.| ...|.|..|.:..||||... ..:.|...|||
  Rat   444 TVEIHPDTSSLTVLSTAAMQDGSTVLKVVSPLQLLTLPGLGPTLQNVAQASPAGSTIVTMPTAAA 508

  Fly   888 TGATAGAGTV-TGAVA 902
            ||......|: ..|||
  Rat   509 TGPEEHTATIEVAAVA 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SamuelNP_001260372.1 SAM_Samd7,11 795..862 CDD:188978 14/75 (19%)
SAM 795..852 CDD:197735 10/64 (16%)
Gmeb2NP_113991.2 SAND 90..163 CDD:128554
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.