DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Samuel and sp100.3

DIOPT Version :9

Sequence 1:NP_001260372.1 Gene:Samuel / 34530 FlyBaseID:FBgn0032330 Length:968 Species:Drosophila melanogaster
Sequence 2:XP_021329292.1 Gene:sp100.3 / 555649 ZFINID:ZDB-GENE-130530-997 Length:599 Species:Danio rerio


Alignment Length:236 Identity:45/236 - (19%)
Similarity:82/236 - (34%) Gaps:65/236 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 TTASTATKRKHLERLASDLRQLGKKG-----RRSRSVSPCS--RYPAVAETARMLSERSLLLSGY 113
            |....:.:|..:|.|..:..|..|.|     |..||..|.|  :.|:.:...:...||..:||.|
Zfish   110 TVTKFSEERIGIETLTENSGQKEKNGTYNRKRNDRSDDPGSSAKKPSFSPHEKGSKERIWMLSRY 174

  Fly   114 -----------------GAIESSAKKLSEAATGGAGGGGGGAAGQAATPTTSQLSAPASSASSSS 161
                             ..:....|.:.|           ||.|:..:|:..:..|...|:.:..
Zfish   175 KTQLPVKCGDKEGILYRDKLAKGEKCIRE-----------GAQGRWFSPSEFEKFAGKESSRNWK 228

  Fly   162 MSSSSAGSTCTTNANTASVAAAYAAFYLEKVKHEKMDNHKDAP------MVTIHNNNNNNTINNN 220
            .|....|:.                  |:|:..|   ||...|      ..::..:..|.:|:::
Zfish   229 ASIRCDGTP------------------LKKLIEE---NHLQCPPMKNRDRTSVRKSKKNISISSS 272

  Fly   221 NSSSSSSSSIINNHQSSQPSLGHSVKRERLSPGSNSSSHNG 261
            .|||:.|.:..::.:.|:   ...|:::....|..|...:|
Zfish   273 ESSSTDSETSASSEEESE---AEDVQKQSKRAGLRSQFRSG 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SamuelNP_001260372.1 SAM_Samd7,11 795..862 CDD:188978
SAM 795..852 CDD:197735
sp100.3XP_021329292.1 HSR 12..108 CDD:308673
SAND 178..247 CDD:307487 14/100 (14%)
SAND 327..401 CDD:307487
PHD_TIF1_like 428..471 CDD:277016
Bromodomain 499..598 CDD:321986
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.