DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Samuel and gmeb-3

DIOPT Version :9

Sequence 1:NP_001260372.1 Gene:Samuel / 34530 FlyBaseID:FBgn0032330 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_497762.2 Gene:gmeb-3 / 175487 WormBaseID:WBGene00008092 Length:376 Species:Caenorhabditis elegans


Alignment Length:204 Identity:39/204 - (19%)
Similarity:69/204 - (33%) Gaps:42/204 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 LAPPPTAPSPTEQAKSQMA----------AVVAAASVSPFMTNFLPFSSGI-----FPPLIDMSS 580
            ||....|..||||:..|::          ......:.:....||:.....:     |.|.....|
 Worm   182 LASGDDASEPTEQSSGQISEEPIKKRGRGRPAGKKNKAKLEINFVESEDQLVFEEFFQPAFSTRS 246

  Fly   581 TQALLTLARAVKDAEIQEILR-------SKQQRSGSNASSPSASAAGTPR-SSSTLNAALHQAAQ 637
            ......:....:|  |...|:       |:.:|||..:.......||... ..|.:..:|:|.:.
 Worm   247 PAPERPVCSPAQD--IYSCLQNDPMSFWSQIKRSGFISQFCDDIIAGAINLKQSAMTQSLNQNSA 309

  Fly   638 FVTPALIYSAQLQQQQQQQQQQHQRQ-QQQQSQHASRQSSPRSTNDSTTVAPIGDGGGGSSIASA 701
            ||.....::..:|:....:.|..:|. .:|:.|:...:...:...|:.|.|.             
 Worm   310 FVLTRATFALGIQKPIVNRVQSIERNVNEQKKQNEMMEDQGKYQEDAQTEAD------------- 361

  Fly   702 APLDLSSQP 710
               ||.:||
 Worm   362 ---DLDNQP 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SamuelNP_001260372.1 SAM_Samd7,11 795..862 CDD:188978
SAM 795..852 CDD:197735
gmeb-3NP_497762.2 SAND 74..147 CDD:128554
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.