Sequence 1: | NP_001260372.1 | Gene: | Samuel / 34530 | FlyBaseID: | FBgn0032330 | Length: | 968 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497762.2 | Gene: | gmeb-3 / 175487 | WormBaseID: | WBGene00008092 | Length: | 376 | Species: | Caenorhabditis elegans |
Alignment Length: | 204 | Identity: | 39/204 - (19%) |
---|---|---|---|
Similarity: | 69/204 - (33%) | Gaps: | 42/204 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 531 LAPPPTAPSPTEQAKSQMA----------AVVAAASVSPFMTNFLPFSSGI-----FPPLIDMSS 580
Fly 581 TQALLTLARAVKDAEIQEILR-------SKQQRSGSNASSPSASAAGTPR-SSSTLNAALHQAAQ 637
Fly 638 FVTPALIYSAQLQQQQQQQQQQHQRQ-QQQQSQHASRQSSPRSTNDSTTVAPIGDGGGGSSIASA 701
Fly 702 APLDLSSQP 710 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Samuel | NP_001260372.1 | SAM_Samd7,11 | 795..862 | CDD:188978 | |
SAM | 795..852 | CDD:197735 | |||
gmeb-3 | NP_497762.2 | SAND | 74..147 | CDD:128554 | |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4333 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |