Sequence 1: | NP_001260372.1 | Gene: | Samuel / 34530 | FlyBaseID: | FBgn0032330 | Length: | 968 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006573.2 | Gene: | GMEB1 / 10691 | HGNCID: | 4370 | Length: | 573 | Species: | Homo sapiens |
Alignment Length: | 265 | Identity: | 48/265 - (18%) |
---|---|---|---|
Similarity: | 84/265 - (31%) | Gaps: | 91/265 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 595 EIQEILRSKQQRSGSNASSPSASAAGTPRSSSTLNAALHQAAQFVTPALIYSAQLQQQQQQQQQ- 658
Fly 659 -----QHQRQQQQQSQHASRQSSPRSTNDSTTVAPIGDGGGGSSIASAAPLDLSSQPPAAKRFKA 718
Fly 719 ERRASSTATT-------------------------------ATTATTGSSTST----PSPPPLEQ 748
Fly 749 HDDINSG-----------NANATLGTRSGTGTGESSAAGS-------------GAGVAKARRRCQ 789
Fly 790 AQSEE 794 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Samuel | NP_001260372.1 | SAM_Samd7,11 | 795..862 | CDD:188978 | 48/265 (18%) |
SAM | 795..852 | CDD:197735 | 48/265 (18%) | ||
GMEB1 | NP_006573.2 | SAND | 90..165 | CDD:396076 | |
KDWK motif | 143..147 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 370..398 | 9/45 (20%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4333 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |