DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Samuel and GMEB1

DIOPT Version :9

Sequence 1:NP_001260372.1 Gene:Samuel / 34530 FlyBaseID:FBgn0032330 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_006573.2 Gene:GMEB1 / 10691 HGNCID:4370 Length:573 Species:Homo sapiens


Alignment Length:265 Identity:48/265 - (18%)
Similarity:84/265 - (31%) Gaps:91/265 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   595 EIQEILRSKQQRSGSNASSPSASAAGTPRSSSTLNAALHQAAQFVTPALIYSAQLQQQQQQQQQ- 658
            ||:|:||..|||        ...|......::.||...|......|...:...:..|.:|.::| 
Human   279 EIEELLRGVQQR--------LIQAPFQVTDAAVLNNVAHTFGLMDTVKKVLDNRRNQVEQGEEQF 335

  Fly   659 -----QHQRQQQQQSQHASRQSSPRSTNDSTTVAPIGDGGGGSSIASAAPLDLSSQPPAAKRFKA 718
                 ..:||.::|.:..........|..:..:.|:                  |.|...||.:.
Human   336 LYTLTDLERQLEEQKKQGQDHRLKSQTVQNVVLMPV------------------STPKPPKRPRL 382

  Fly   719 ERRASSTATT-------------------------------ATTATTGSSTST----PSPPPLEQ 748
            :|.||:|..:                               ..|.:.|||..|    ||.|.|.:
Human   383 QRPASTTVLSPSPPVQQPQFTVISPITITPVGQSFSMGNIPVATLSQGSSPVTVHTLPSGPQLFR 447

  Fly   749 HDDINSG-----------NANATLGTRSGTGTGESSAAGS-------------GAGVAKARRRCQ 789
            :..:.|.           :.:::|...|.|...:.|..|:             .:|:..|.:..:
Human   448 YATVVSSAKSSSPDTVTIHPSSSLALLSSTAMQDGSTLGNMTTMVSPVELVAMESGLTSAIQAVE 512

  Fly   790 AQSEE 794
            :.||:
Human   513 STSED 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SamuelNP_001260372.1 SAM_Samd7,11 795..862 CDD:188978 48/265 (18%)
SAM 795..852 CDD:197735 48/265 (18%)
GMEB1NP_006573.2 SAND 90..165 CDD:396076
KDWK motif 143..147
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 370..398 9/45 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.