DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Samuel and samd7

DIOPT Version :9

Sequence 1:NP_001260372.1 Gene:Samuel / 34530 FlyBaseID:FBgn0032330 Length:968 Species:Drosophila melanogaster
Sequence 2:XP_004914482.1 Gene:samd7 / 100496820 XenbaseID:XB-GENE-948462 Length:534 Species:Xenopus tropicalis


Alignment Length:338 Identity:78/338 - (23%)
Similarity:123/338 - (36%) Gaps:104/338 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   664 QQQQSQHASRQSSPRSTNDSTTVAPIGDGGGGSSIASAAPLDLSSQPPAAKRFKAERRASSTATT 728
            |:::::...|::..:...|...||.|.        |...|   .|.|......|.|::...|.|.
 Frog   231 QRERARRPGRRAGNQKATDHMGVAKIQ--------ADNKP---PSPPAPTDEEKDEKKDEETGTM 284

  Fly   729 A---------TTATTGSSTSTPSPPPLEQHD---DINSGNANATLGTRSGTGTG----------- 770
            :         ..|...||:....|..:...:   :|.:|.:....|. :.|||.           
 Frog   285 SKCDQIKTEVQPALDKSSSELQDPQKMSNQNIPREIANGRSEMDKGP-NNTGTAFEERYIYQPPV 348

  Fly   771 ESSAAGSGAGVAK------------ARRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQSFRDQ 823
            ..||......||.            ..|......|::..|:..||..|:..:..|:.|.|.|:|.
 Frog   349 HLSATPYSFPVAMNSPLLPGTQGLFLTREDLPSVEDIRKWNSQDVYNFILNLPGCSSYAQVFKDH 413

  Fly   824 SIDGTGLPLLTEDHLVNSLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLALQTGGAAAAT 888
            .|||..||||||:||::::|:|||||||:||.:..:||          ....|.:||        
 Frog   414 DIDGLTLPLLTEEHLLDTMGLKLGPALKIRSQIICRLG----------NIFHMPSLQ-------- 460

  Fly   889 GATAGAGTVTGAVAGAGATSATTSCSIKSEIFNGGSNGSSSGSSSNQGSDVAAPPAATASSPSSN 953
                    :||:::                        |::.......|:|.:|...|.:|    
 Frog   461 --------LTGSIS------------------------STAPMPPEHPSEVVSPLPCTNNS---- 489

  Fly   954 MLLPVLPCSGLQD 966
               .:||..|.||
 Frog   490 ---DILPSPGPQD 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SamuelNP_001260372.1 SAM_Samd7,11 795..862 CDD:188978 31/66 (47%)
SAM 795..852 CDD:197735 27/56 (48%)
samd7XP_004914482.1 SAM_Samd7,11 385..452 CDD:188978 32/76 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48365
Panther 1 1.100 - - O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.100

Return to query results.
Submit another query.