DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and Prmt6

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_849222.3 Gene:Prmt6 / 99890 MGIID:2139971 Length:378 Species:Mus musculus


Alignment Length:326 Identity:130/326 - (39%)
Similarity:177/326 - (54%) Gaps:42/326 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            |::.|.::.:||.|:.|:.|.|||...||.|....:.|.|:||||||||||.|||:||||.||||
Mouse    50 YYECYSDVSVHEEMIADQVRTEAYRLGILKNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAV 114

  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134
            |||.: .:.|.:::..|||.:.|.|:...||...||   |:||.|||||||:.||||.||.|||.
Mouse   115 EASAI-WQQAREVVRLNGLEDRVHVLPGPVETVELP---ERVDAIVSEWMGYGLLHESMLSSVLH 175

  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLFDDW-----------HNVDGIKMDTFARKLRTQKSS 188
            ||.|:|||||||.|:...:||||.|...|  :|           :.||...|::||.:.....| 
Mouse   176 ARTKWLKEGGLLLPASAELFVAPISDQML--EWRLGFWSQVKQHYGVDMSCMESFATRCLMGHS- 237

  Fly   189 RPEITQLNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNHQ----------GFCIW 243
                 ::..|||..|.|:........:|   |.....::.:.|...|..:          ||.:|
Mouse   238 -----EIVVQDLSGEDVLARPQRFAQLE---LARAGLEQELEAGVGGRFRCSCYGSAPLHGFAVW 294

  Fly   244 FDVQFPGED----FVLSTSPLSPPTHWKQCVVVLPEESCENLEEKSPIAFQITMKRSAADMRKYN 304
            |.|.|||.|    .||||||..|.|||||.::.|.|.  ..:|:.:.|:.:||:..|..:.|:..
Mouse   295 FQVTFPGGDSEKPLVLSTSPFHPATHWKQALLYLNEP--VPVEQDTDISGEITLLPSPDNPRRLR 357

  Fly   305 L 305
            :
Mouse   358 I 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 103/259 (40%)
Methyltransf_18 40..147 CDD:289607 64/106 (60%)
Prmt6NP_849222.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
Methyltransf_18 85..188 CDD:289607 64/106 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H10024
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1503
OMA 1 1.010 - - QHG54098
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106082
Panther 1 1.100 - - LDO PTHR11006
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5237
SonicParanoid 1 1.000 - - X4197
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.800

Return to query results.
Submit another query.