DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and Prmt3

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_446009.1 Gene:Prmt3 / 89820 RGDID:620413 Length:528 Species:Rattus norvegicus


Alignment Length:335 Identity:125/335 - (37%)
Similarity:183/335 - (54%) Gaps:48/335 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            ||..|.:..|||.||||:.|.|:|.:.|..|..:||||:|:|||.||||||.|.|||||:.|.||
  Rat   217 YFSSYGHYGIHEEMLKDKVRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVIAV 281

  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134
            :.|.:..: |:|:|..|.|.:.:.:|:.::||..||  .||||:|:|||||::||.|.||||||.
  Rat   282 DQSEILYQ-AMDIIRLNKLEDTIVLIKGKIEEVSLP--VEKVDVIISEWMGYFLLFESMLDSVLY 343

  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD----WHNVDGIKMDTFARKLRTQKSSRPE-ITQ 194
            |:.|:|.:||.::|..|||.:...|..|...|    |.:|.|..|...      :|:..|| :.:
  Rat   344 AKSKYLAKGGSVYPDICTISLVAVSDVSKHADRIAFWDDVYGFNMSCM------KKAVIPEAVVE 402

  Fly   195 L--------NPQDLLHEGVVFHWMNLLDVE-ASDLDSIQFKEVITAQKAGNHQGFCIWFDVQFP- 249
            :        :|.|:.|  :..|..::.|:| :||......|..:....||       :||:.|. 
  Rat   403 VVDHKTLISDPCDIKH--IDCHTTSISDLEFSSDFTLRTTKTAMCTAVAG-------YFDIYFEK 458

  Fly   250 --GEDFVLSTSPLSPPTHWKQCVVVL----PEESCENLEEKSPIAFQITMKRSAADMRKYNLEVD 308
              ....|.||.|.|..|||||.:.:|    |.::.|.|:.|      ||:.::..|.|  :|.|.
  Rat   459 NCHNRVVFSTGPQSTKTHWKQTIFLLEKPFPVKAGEALKGK------ITVHKNKKDPR--SLIVT 515

  Fly   309 L-LDPNTEEH 317
            | |:.:|:.:
  Rat   516 LTLNSSTQTY 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 98/252 (39%)
Methyltransf_18 40..147 CDD:289607 57/106 (54%)
Prmt3NP_446009.1 zf-C2H2_2 48..>97 CDD:289522
AdoMet_MTases 256..356 CDD:100107 54/102 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.