DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and TMT1

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_011102.3 Gene:TMT1 / 856922 SGDID:S000000977 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:215 Identity:38/215 - (17%)
Similarity:83/215 - (38%) Gaps:56/215 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YYNAILGNKDLFKD---KIVMDVGAGTGILSAFCAKAGARLVYAVEASNVATKVALDLIEDNGLT 89
            :|..|    |.:.|   |:::|||.|.|..:...|:........:.:...||.:....:...|..
Yeast    25 FYKMI----DEYHDGERKLLVDVGCGPGTATLQMAQELKPFEQIIGSDLSATMIKTAEVIKEGSP 85

  Fly    90 NVVKVIQSRV---EEF-VLPAEA---EKVDIIV----SEWMGFYLLHEGMLDSVLLARDKFLKEG 143
            :..|.:..::   ::| .|.|::   :|:|:|.    :.|..|               :||.:..
Yeast    86 DTYKNVSFKISSSDDFKFLGADSVDKQKIDMITAVECAHWFDF---------------EKFQRSA 135

  Fly   144 GLLFPSECTIFVAPCSVPSLFDDWHNVDGIKMDT----------FARKLRTQKSSRPEITQLNPQ 198
            ......:.||.:...:.| :|.|:...|.:.::.          :.:..|::..:..:.:.|:|:
Yeast   136 YANLRKDGTIAIWGYADP-IFPDYPEFDDLMIEVPYGKQGLGPYWEQPGRSRLRNMLKDSHLDPE 199

  Fly   199 DLLHEGVVFHWMNLLDVEAS 218
                   :||     |::.|
Yeast   200 -------LFH-----DIQVS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 38/215 (18%)
Methyltransf_18 40..147 CDD:289607 22/120 (18%)
TMT1NP_011102.3 AdoMet_MTases 33..>147 CDD:418430 24/128 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.