DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and ERG6

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_013706.1 Gene:ERG6 / 855003 SGDID:S000004467 Length:383 Species:Saccharomyces cerevisiae


Alignment Length:235 Identity:50/235 - (21%)
Similarity:80/235 - (34%) Gaps:82/235 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RQEAY--YNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAVEASNVATKVALDLIEDN 86
            |.|.|  |.|.:...||     |:|||.|.|        ..||.:......||.           
Yeast   106 RHEHYLAYKAGIQRGDL-----VLDVGCGVG--------GPAREIARFTGCNVI----------- 146

  Fly    87 GLTN----VVKVIQSRVEEFVLPAEAEKVDIIVSEWMGF----------YLL----HEGMLDSVL 133
            ||.|    :.|. :...:::.|   ::::|.:..::|..          |.:    |...|:.|.
Yeast   147 GLNNNDYQIAKA-KYYAKKYNL---SDQMDFVKGDFMKMDFEENTFDKVYAIEATCHAPKLEGVY 207

  Fly   134 LARDKFLKEGGLLFPSECTIFVAPCSVPSLFDDWHNVDGIKMDTFARKLRTQKSSRPEITQLNPQ 198
            ....|.||.||.....|                |...|  |.|          .:.||..::..:
Yeast   208 SEIYKVLKPGGTFAVYE----------------WVMTD--KYD----------ENNPEHRKIAYE 244

  Fly   199 DLLHEGV--VFHWMNLLDVEASDLDSIQFKEVITAQKAGN 236
            ..|.:|:  :||    :||....|.:..|:.:::...|.|
Yeast   245 IELGDGIPKMFH----VDVARKALKNCGFEVLVSEDLADN 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 50/235 (21%)
Methyltransf_18 40..147 CDD:289607 26/124 (21%)
ERG6NP_013706.1 Cfa 66..>277 CDD:225139 48/230 (21%)
Methyltransf_11 124..222 CDD:400514 25/120 (21%)
Sterol_MT_C 306..368 CDD:400686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.