DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and TRM9

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_013698.1 Gene:TRM9 / 854994 SGDID:S000004476 Length:279 Species:Saccharomyces cerevisiae


Alignment Length:213 Identity:39/213 - (18%)
Similarity:69/213 - (32%) Gaps:56/213 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LEIHELMLKDRPRQEAYYNAILGNKDLFKDK----------------IVMDVGAGTGILSAFCAK 60
            :||::...|::......||.|..:....:.|                |.:|||.|.|      ..
Yeast     1 MEINQAAEKEQEYVHKVYNEIAPHFSQTRYKPWPIVTQFLKTRPMGSIGIDVGCGNG------KY 59

  Fly    61 AGARL-VYAVEASNVATKVALDLIEDNGLTNVVKVIQSRVEEFV-----LPAEAEKVDI-----I 114
            .|... :|.:.:.           ..:||....:.|.......|     ||.:.|..|.     :
Yeast    60 LGVNPDIYIIGSD-----------RSDGLIECARGINPSYNLLVADGLNLPHKNETFDFAISIAV 113

  Fly   115 VSEWMGFYLLHEGMLDSVLLARDKFLKEGGLLFPSECTIFVAPCSVPSLFDDWHNVDGIKMDTFA 179
            |..|.    ..|..::.:.....| |::||     :..|:.......|....:|  :|::.|.|.
Yeast   114 VHHWS----TRERRVEVIRHVLSK-LRQGG-----QALIYCWALEQGSSRRGYH--EGMEQDVFV 166

  Fly   180 RKLRTQKSSRPEITQLNP 197
            ..:..:..|:|:.....|
Yeast   167 PWVLPKSKSKPKTKSTPP 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 39/213 (18%)
Methyltransf_18 40..147 CDD:289607 24/133 (18%)
TRM9NP_013698.1 Methyltransf_25 51..138 CDD:404528 20/108 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.