DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and OMS1

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_010602.3 Gene:OMS1 / 851911 SGDID:S000002724 Length:471 Species:Saccharomyces cerevisiae


Alignment Length:241 Identity:43/241 - (17%)
Similarity:79/241 - (32%) Gaps:75/241 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 DSVLLARDKFLKEGGLLFPSECTIFVAPCSVPSLFDDWHNVDGIKMDTF-ARKLRTQKSSRPEIT 193
            |.:.|...|.::|.|:                      .|.|.|::..| ..||..|.....:.|
Yeast   165 DELKLEEYKKMQEEGI----------------------ENFDDIRVQNFDQNKLNEQILPARDTT 207

  Fly   194 -----QLNPQDL---LHEGVVF-----HWM-----------------NLLDVEASDLDSIQFKEV 228
                 :.|..|.   :.|.|:|     .|:                 |:..::.|.::||.|.:.
Yeast   208 NFYQEKANEYDKAINMEERVIFLGKRRKWLMKHCQGDVLEVSCGTGRNIKYLDMSRINSITFLDS 272

  Fly   229 ITAQKAGNHQGFCIWFDVQFPGEDFVLSTSPLSPPTHWKQCVVVLPEESCENLEEKSPIAFQITM 293
            ........|:.|         .|.|         |.:.|...||...|:..:|.||.    :.::
Yeast   273 SENMMEITHKKF---------REKF---------PKYKKVAFVVGKAENLVDLAEKG----KPSL 315

  Fly   294 KRSAADMRKYNLEVDLLDPNTEEHPVPCSCHMTKCILTEAHLKMMD 339
            :....:..||:..|:.....:.|.||....:..|.:..:..:.:::
Yeast   316 ENEKENQVKYDTIVEAFGLCSHEDPVKALNNFGKLLKPDGRIILLE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 26/144 (18%)
Methyltransf_18 40..147 CDD:289607 5/16 (31%)
OMS1NP_010602.3 Methyltransf_25 245..355 CDD:404528 24/131 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.