DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and PRMT6

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001326463.1 Gene:PRMT6 / 821541 AraportID:AT3G20020 Length:443 Species:Arabidopsis thaliana


Alignment Length:354 Identity:124/354 - (35%)
Similarity:192/354 - (54%) Gaps:46/354 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            ||..|.::.|||.|:|||.|.|.|..||:.::.|.:.|:|:|||.||||||.|||:|||:.||||
plant    83 YFHSYAHVGIHEEMIKDRARTETYREAIMQHQSLIEGKVVVDVGCGTGILSIFCAQAGAKRVYAV 147

  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134
            :||::|.: |.::::.|||::.|.|:..|||:..:.   |:||:|:|||||:.||:|.||.||:.
plant   148 DASDIAVQ-AKEVVKANGLSDKVIVLHGRVEDVEID---EEVDVIISEWMGYMLLYESMLGSVIT 208

  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLF----DDWHNVDGIKMDTFARKLRTQKSSRPEITQL 195
            |||::||.|||:.||..|:::||.|.|..:    |.|.||.||.|....:..:......|.:..:
plant   209 ARDRWLKPGGLILPSHATLYMAPISHPDRYSHSIDFWRNVYGIDMSAMMQLAKQCAFEEPSVESI 273

  Fly   196 NPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNHQGFCIWFDVQF------------ 248
            :.:::|....|...::...::..:|||:..:....:.......||..||||:|            
plant   274 SGENVLTWPEVVKHIDCKTIKIQELDSVTARYKFNSMMRAPMHGFAFWFDVEFSGPASSPAKNTS 338

  Fly   249 ------------------------PGEDFVLSTSPLSPPTHWKQCVVVLPEESCENLEEKSPIAF 289
                                    |.:..||||||.||||||:|.:|...:..  ::|:...|..
plant   339 ETSIASGSSSISPSGEVNQKKRTNPSDALVLSTSPESPPTHWQQTIVYFYDPI--DVEQDQVIEG 401

  Fly   290 QITMKRSAADMRKYNLEVDLLDPNTEEHP 318
            .:|:.:|..:.|..|:.::.....|..||
plant   402 SVTLSQSKENKRFMNIHLEYSLVATLFHP 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 95/242 (39%)
Methyltransf_18 40..147 CDD:289607 57/106 (54%)
PRMT6NP_001326463.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H10024
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106082
Panther 1 1.100 - - O PTHR11006
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4197
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.