DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and PRMT3

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_187835.2 Gene:PRMT3 / 820407 AraportID:AT3G12270 Length:601 Species:Arabidopsis thaliana


Alignment Length:354 Identity:125/354 - (35%)
Similarity:171/354 - (48%) Gaps:51/354 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            ||..|.:..||..||.|:.|.|||.:|:|.|..|....:|||||.||||||.|.|||||..|.||
plant   245 YFGSYSSFGIHREMLSDKVRTEAYRDALLKNPTLLNGSVVMDVGCGTGILSLFAAKAGASRVVAV 309

  Fly    70 EAS----NVATKVALD--LIEDNGLTNVVKVIQSRVEEF--VLPAEAEKVDIIVSEWMGFYLLHE 126
            |||    .||||:|.|  :..||....|::|..|.|||.  .:..:...||::||||||:.||:|
plant   310 EASEKMAKVATKIAKDNKVFNDNEHNGVLEVAHSMVEELDKSIQIQPHSVDVLVSEWMGYCLLYE 374

  Fly   127 GMLDSVLLARDKFLKEGGLLFPSECTIFVA-----PCSVPSLFDDWHNVDGIKMDTFARKLRTQK 186
            .||.|||.|||::||.||.:.|...|:|||     ..|:|.    |.:|.|..|.:..:::....
plant   375 SMLSSVLYARDRWLKPGGAILPDTATMFVAGFGKGATSLPF----WEDVYGFDMSSIGKEIHDDT 435

  Fly   187 SSRPEITQLNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNH------QGFCIWFD 245
            :..|.:..:..:||:.:..:   :...|:.....|.:.|....|.:...:.      .|..:|||
plant   436 TRLPIVDVIAERDLVTQPTL---LQTFDLATMKPDEVDFTATATLEPTESEAKTRLCHGVVLWFD 497

  Fly   246 VQFPG-----EDFVLSTSPLSPPTHWKQCVVVLPEESCENLEEKSPIAFQITMKRSAADMRKYNL 305
            ..|..     ...||||||.:|||||.|.::...|          ||:.......|..|.|:   
plant   498 TGFTSRFCKENPTVLSTSPYTPPTHWAQTILTFQE----------PISVAPASVLSGNDRRE--- 549

  Fly   306 EVDLLDPNTEEHPVPCSCHMTKCILTEAH 334
                 ...|||.|. .|.|: :..:..||
plant   550 -----AIGTEECPA-SSIHL-RVSVARAH 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 95/257 (37%)
Methyltransf_18 40..147 CDD:289607 60/114 (53%)
PRMT3NP_187835.2 zf-C2H2_2 57..>112 CDD:403839
AdoMet_MTases 232..>330 CDD:418430 45/84 (54%)
Methyltransf_25 284..392 CDD:404528 58/107 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11006
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.