DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and Mettl27

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_006504585.1 Gene:Mettl27 / 79565 MGIID:1933146 Length:266 Species:Mus musculus


Alignment Length:240 Identity:51/240 - (21%)
Similarity:80/240 - (33%) Gaps:86/240 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DKIVMDVGAGTGILSAFCAKAGARLVYAVEASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLP 105
            |.:::||..|||:::......|...|..|:.|....|.|    ...||.:.:.:.....|....|
Mouse    68 DALILDVACGTGLVAVELQARGFLQVQGVDGSPEMLKQA----RARGLYHHLSLCTLGQEPLPDP 128

  Fly   106 AEAEKVDIIVSEWMGFYLLHEGMLDSVLLARDKFLKEGGLLFPSECTIFVAPCS-VPSLF----- 164
                                ||..|:|::.  ..|.||.:           ||| :|.|.     
Mouse   129 --------------------EGTFDAVIIV--GALSEGQV-----------PCSAIPELLRVTKP 160

  Fly   165 -DDWHNVD---GIKMD--TFARKLRTQKSSRPEI-TQLNPQDLLHEGVVFHWMNLLDVEASDLDS 222
             ...|...   |...|  .||..|...:.....: |:.||.:|.::..         :||: |||
Mouse   161 GSCPHQTTVTVGYSHDREAFASALVPDRGGLVCLTTRTNPSNLPYKET---------LEAT-LDS 215

  Fly   223 IQFKEVITAQKAGNHQGFCIWFDVQFPGEDFVLSTSPLSPPTHWK 267
            :        ::||      :|         ..|.|.|:.   ||:
Mouse   216 L--------ERAG------VW---------ECLVTQPVD---HWE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 45/215 (21%)
Methyltransf_18 40..147 CDD:289607 23/105 (22%)
Mettl27XP_006504585.1 AdoMet_MTases 31..>103 CDD:388410 10/34 (29%)
Methyltransf_25 71..161 CDD:379312 27/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.