DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and Prmt3

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_598501.1 Gene:Prmt3 / 71974 MGIID:1919224 Length:528 Species:Mus musculus


Alignment Length:335 Identity:125/335 - (37%)
Similarity:182/335 - (54%) Gaps:48/335 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            ||..|.:..|||.||||:.|.|:|.:.|..|..:||||:|:|||.||||||.|.||.||:.|.||
Mouse   217 YFSSYGHYGIHEEMLKDKVRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKVGAKKVIAV 281

  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134
            :.|.:..: |:|:|..|.|.:.:.:|:.::||..||  .||||:|:|||||::||.|.||||||.
Mouse   282 DQSEILYQ-AMDIIRLNKLEDTIVLIKGKIEEVSLP--VEKVDVIISEWMGYFLLFESMLDSVLY 343

  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD----WHNVDGIKMDTFARKLRTQKSSRPE-ITQ 194
            |:.|:|.:||.::|..|||.:...|..|...|    |.:|.|..|...      :|:..|| :.:
Mouse   344 AKSKYLAKGGSVYPDICTISLVAVSDVSKHADRIAFWDDVYGFNMSCM------KKAVIPEAVVE 402

  Fly   195 L--------NPQDLLHEGVVFHWMNLLDVE-ASDLDSIQFKEVITAQKAGNHQGFCIWFDVQFP- 249
            :        :|.|:.|  :..|..::.|:| :||......|..:....||       :||:.|. 
Mouse   403 VVDHKTLISDPCDIKH--IDCHTTSISDLEFSSDFTLRTTKTAMCTAVAG-------YFDIYFEK 458

  Fly   250 --GEDFVLSTSPLSPPTHWKQCVVVL----PEESCENLEEKSPIAFQITMKRSAADMRKYNLEVD 308
              ....|.||.|.|..|||||.|.:|    |.::.|.|:.|      ||:.::..|.|  :|.|.
Mouse   459 NCHNRVVFSTGPQSTKTHWKQTVFLLEKPFPVKAGEALKGK------ITVHKNKKDPR--SLIVT 515

  Fly   309 L-LDPNTEEH 317
            | |:.:|:.:
Mouse   516 LTLNSSTQTY 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 97/252 (38%)
Methyltransf_18 40..147 CDD:289607 56/106 (53%)
Prmt3NP_598501.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
zf-C2H2_2 48..>97 CDD:289522
AdoMet_MTases 256..356 CDD:100107 53/102 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.