Sequence 1: | NP_609478.1 | Gene: | Art8 / 34528 | FlyBaseID: | FBgn0032329 | Length: | 341 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_082129.2 | Gene: | Mettl7b / 71664 | MGIID: | 1918914 | Length: | 244 | Species: | Mus musculus |
Alignment Length: | 258 | Identity: | 42/258 - (16%) |
---|---|---|---|
Similarity: | 79/258 - (30%) | Gaps: | 98/258 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MANTYFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARL 65
Fly 66 VYAVEASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLD 130
Fly 131 SVLLARDKFLKEGGLLFPSECTIFVAPCSVPSLFDDWHNVDGIKMDTFARKL--RTQKSSRPEIT 193
Fly 194 QLNPQDLLHEGVVFHWMNLLDVEAS----------------------------DLDSIQFKEV 228 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Art8 | NP_609478.1 | SmtA | 1..244 | CDD:223574 | 42/258 (16%) |
Methyltransf_18 | 40..147 | CDD:289607 | 16/106 (15%) | ||
Mettl7b | NP_082129.2 | SmtA | 33..>192 | CDD:223574 | 37/226 (16%) |
Methyltransf_11 | 75..172 | CDD:285453 | 28/164 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |