DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and Prmt8

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001258314.1 Gene:Prmt8 / 688502 RGDID:1587677 Length:394 Species:Rattus norvegicus


Alignment Length:313 Identity:114/313 - (36%)
Similarity:170/313 - (54%) Gaps:20/313 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            |||.|.:..|||.||||..|...|.|::..||.:||||:|:|||:||||||.|.|||||:.|:.:
  Rat    76 YFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGI 140

  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134
            |.|:: :..:..:|:.|.|.||:.:.:.:|||..||  .||||||:|||||:.|.:|.||::|:.
  Rat   141 ECSSI-SDYSEKIIKANHLDNVITIFKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVIF 202

  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD----WHNVDGIKMDTFARKLRTQKSSRPEITQL 195
            ||||:||.|||:||....::|.........|.    |.||.|..|..    :|......|.:..:
  Rat   203 ARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTC----IRDVAMKEPLVDIV 263

  Fly   196 NPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNH--QGFCIWFDVQFP--GEDFVLS 256
            :|:.::....:...:::..|:..:|   .|......|...|.  .....:|:::|.  .:....|
  Rat   264 DPKQVVTNACLIKEVDIYTVKTEEL---SFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFS 325

  Fly   257 TSPLSPPTHWKQCVVVLPEESCENLEEKSPIAFQITMKRSAADMRKYNLEVDL 309
            |:|.:|.|||||.|..|  |....:.....|...|:||.:|.::|..:..|||
  Rat   326 TAPDAPYTHWKQTVFYL--EDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDL 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 91/244 (37%)
Methyltransf_18 40..147 CDD:289607 57/106 (54%)
Prmt8NP_001258314.1 AdoMet_MTases 115..215 CDD:100107 54/102 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.