DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Art8 and Alkbh8

DIOPT Version :9

Sequence 1:	NP_609478.1	Gene:	Art8 / 34528	FlyBaseID:	FBgn0032329	Length:	341	Species:	Drosophila melanogaster
Sequence 2:	XP_006509942.1	Gene:	Alkbh8 / 67667	MGIID:	1914917	Length:	709	Species:	Mus musculus

Alignment Length:	110	Identity:	23/110 - (20%)
Similarity:	34/110 - (30%)	Gaps:	46/110 - (41%)

- Green bases have known domain annotations that are detailed below.

  Fly   229 ITAQKAGNHQGFCIWFD-----------------------------------VQFPGEDFVLSTS 258
            :|.|..|.|  |||..:                                   |.:|.:..|::..
Mouse    33 LTKQLGGEH--FCITMNINHKGVLKLTKMEKKFLRKQSKARHVLLKHEGIQAVSYPTQSLVIANG 95

  Fly   259 PLSPPTHWKQCVVVLPEESCENLE-----EKSPIAFQI--TMKRS 296
            .|......||.::.|  |.|..:|     ...|.||.|  |::.|
Mouse    96 GLGNGVSRKQLLLTL--EKCGPVEALLMPPNKPYAFVIFQTIEES 138

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Art8	NP_609478.1	SmtA	1..244	CDD:223574	7/14 (50%)
Art8	NP_609478.1	Methyltransf_18	40..147	CDD:289607
Alkbh8	XP_006509942.1	DUF1891	46..82	CDD:117570	0/35 (0%)
		RRM_ALKBH8	87..167	CDD:240877	14/54 (26%)
		2OG-FeII_Oxy	197..379	CDD:389772
		Methyltransf_25	455..542	CDD:379312
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0500
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900