DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and Gstcd

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001343238.1 Gene:Gstcd / 67553 MGIID:1914803 Length:634 Species:Mus musculus


Alignment Length:261 Identity:57/261 - (21%)
Similarity:91/261 - (34%) Gaps:75/261 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VATKVALDLIEDN----------------GLTNVVK-VIQSRVEEFVLPAEAEKVDII------- 114
            |.:|.||..|..|                ||..|:: :||...|  ..|:..|.::::       
Mouse    76 VISKQALPPIVQNCCLPAVVDQPDVFCRAGLAVVLRHIIQKSYE--AEPSRKEILELLGFKKTCL 138

  Fly   115 -----VSEWMGFYLLHEGMLDSVLLARDKFLKEGG---LLFPSECTIFVAPCSVPSLFDDWHNVD 171
                 ||:|.....|      ::.||.:.||:|..   ...|.|........|.|...   ||.|
Mouse   139 KACAEVSQWTRLCEL------TIPLAVENFLQESSEHPPTIPEEILELERKLSEPVRV---HNDD 194

  Fly   172 GIKMDTFARKLRTQKSSRPE------------ITQLNPQDL------LHEGVVFHWMNLL-DVEA 217
            .::    .:||:.||::..|            ..|..|:||      |...|.|..:.:. |..|
Mouse   195 KLR----RQKLKQQKAAGSEPPSGKGKAKSKASAQKTPKDLAAPSKSLELKVAFSKLTVQEDAAA 255

  Fly   218 SDLDSIQFKEVITAQKAGNHQGFCIWFDVQFPGEDFVLSTSPLSPPTHWKQCVVVLPEESCENLE 282
            |:.:....::...|........|.       .|..|.|:...|.|..|  ..:|::.::..|.||
Mouse   256 SNREPSHIRKAKAADLPPLEHVFA-------EGLYFTLADIVLLPCIH--HFLVIICKKFSEKLE 311

  Fly   283 E 283
            :
Mouse   312 Q 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 47/220 (21%)
Methyltransf_18 40..147 CDD:289607 23/104 (22%)
GstcdNP_001343238.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..233 12/50 (24%)
GST_C_family <271..330 CDD:322082 11/51 (22%)
AdoMet_MTases 424..542 CDD:327401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.