DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and Carm1

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_067506.2 Gene:Carm1 / 59035 MGIID:1913208 Length:608 Species:Mus musculus


Alignment Length:361 Identity:126/361 - (34%)
Similarity:178/361 - (49%) Gaps:58/361 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            ||..|..|...:.|::|..|...|..|||.|...||||||:|||.|:||||.|.|:||||.:|||
Mouse   150 YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAV 214

  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134
            |||.:|....: |::.|.||:.:.||..:|||..||   |:||||:||.||:.|.:|.||:|.|.
Mouse   215 EASTMAQHAEV-LVKSNNLTDRIVVIPGKVEEVSLP---EQVDIIISEPMGYMLFNERMLESYLH 275

  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD-------W-----HNVD-----GIKMDTFARKL 182
            |: |:||..|.:||:...:.:||.:...|:.:       |     |.||     |..:|.:.|  
Mouse   276 AK-KYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFR-- 337

  Fly   183 RTQKSSRPEITQLNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNHQGFCIWFDVQ 247
                  :|.:...:.:.|:.:.|.: .:|.|:.:..||..|:.........:|...|...||||.
Mouse   338 ------QPVVDTFDIRILMAKSVKY-TVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVA 395

  Fly   248 FPGEDFV--LSTSPLSPPTHWKQ--CVVVLP--EESCENLEEKSPIAFQITMKRSAADM------ 300
            |.|....  |||:|..|.|||.|  |:...|  .::.:.|   |.....|..||.:.|:      
Mouse   396 FIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTL---SGTCLLIANKRQSYDISIVAQV 457

  Fly   301 -----RKYNLEVDLLDP-----NTEEHPVPCSCHMT 326
                 :..|| :||.:|     .|...|.|.| |.|
Mouse   458 DQTGSKSSNL-LDLKNPFFRYTGTTPSPPPGS-HYT 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 92/255 (36%)
Methyltransf_18 40..147 CDD:289607 57/106 (54%)
Carm1NP_067506.2 CARM1 35..139 CDD:402914
AdoMet_MTases 189..284 CDD:100107 52/99 (53%)
Transactivation domain 500..608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.